Total Record - 1

Print this rrecord

 
ProGlyProt ID
AC103
Organism Information
Organism Name
Halobacterium salinarum (halobium) R1M1/NRC-1
Domain
Archaea
Classification
Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
flaA1 (VNG_1008G)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Flagellin A1
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
196 AA
Subcellular Location
Flagellum
Function
Flagellin is the structural subunit of the flagellar filaments.
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
N84, N125
Experimentally Validated Glycosite(s ) in Mature Protein
N84, N125
Glycosite(s) Annotated Protein Sequence
>sp|P61118|FLAA1_HALSA Flagellin A1 OS=Halobacterium salinarium (strain ATCC 700
922 / JCM 11081 / NRC-1) GN=flaA1a PE=3 SV=1 MFEFITDEDERGQVGIGTLIVFIAMVLVAA
IAAGVLINTAGFLQSKGSATGEEASAQVSN RINIVSAYGNVKTASGTDTVDYAN*(84)LTVRQAAGADNIN
LSKSTIQWIGPDTATTLTYDGST ADAEN*(125)FTTESIKGNNADVLVEQSDRIKIVMDAASITTNGLKAG
EEVQLTVTTQYGSKTTY WANVPESLKDKNAVTL
Sequence Around Glycosites (21 AA)
ASGTDTVDYANLTVRQAAGAD
TYDGSTADAENFTTESIKGNN
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Mass shift on SDS-PAGE after deglycosylation with anhydrous hydrogen fluoride.
Technique(s) used for Glycosylated Residue(s) Detection
Glycopeptide sequencing
 
 
Glycan Information
Glycan Annotation
Linkage: Glc-Asn.
Sulfated oligosaccharides that resemble those of the cell-suface glycoprotein in the bacterium are present. Glucose and glucuronic acid are the constituents of the glycans which are of the type GlcA-(1→4)-GlcA-(1→4)-GlcA-(1→4)-Glc.
Technique(s) used for Glycan Identification
GLC-MS (gas liquid chromatography-mass spectrometry) after perfluoropropionylation.
 
 
Literature
Reference(s)
1) Cohen-Krausz, S. and Trachtenberg, S. (2002) The structure of the archeabacterial flagellar filament of the extreme halophile Halobacterium salinarum R1M1 and its relation to eubacterial flagellar filaments and type IV pili. J Mol Biol, 321, 383-395. [PubMed: 12162953]
2) Gerl, L., Deutzmann, R. and Sumper, M. (1989) Halobacterial flagellins are encoded by a multigene family. Identification of all five gene products. FEBS Lett, 244, 137-140. [PubMed: 2924901]
3) Gerl, L. and Sumper, M. (1988) Halobacterial flagellins are encoded by a multigene family. Characterization of five flagellin genes. J Biol Chem, 263, 13246-13251. [PubMed: 3417656]
4) Wieland, F., Paul, G. and Sumper, M. (1985) Halobacterial flagellins are sulfated glycoproteins. J Biol Chem, 260, 15180-15185. [PubMed: 3934156]
Additional Comments
Removal of Mg++ ions in the growth medium inhibits glycosylation of proteins in vivo. This leads to the reduction in the molecular masses of newly synthesized flagellins. There might be another modification of the flagellins that is resistant to HF treatment. Halobacterial glycoproteins including flagellins are glycosylated at the extracellular surface of the cell membrane.
Year of Identification
1985
Year of Validation
1989
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.