Total Record - 1

Print this rrecord

 
ProGlyProt ID
AC111
Organism Information
Organism Name
Methanococcus maripaludis S2
Domain
Archaea
Classification
Family: Methanococcaceae
Order: Methanococcales
Class: Methanococci or Methanothermea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
flaB3 (MMP1668)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
FlaB3
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
210 AA
Subcellular Location
Surface associated
Function
Flagellin
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
(Signal peptide: 1-11) N150, N175
Experimentally Validated Glycosite(s ) in Mature Protein
N139, N164
Glycosite(s) Annotated Protein Sequence
>tr|Q6LWP1|Q6LWP1_METMP Flagellin B3 OS=Methanococcus maripaludis GN=flaB3 PE=3
SV=1 MVKKFMKSKKGAVGIGTLIIFIAMVLVAAIAASVIINTAGKLQHKASTVGEESTEQVASG IQVLKVIG
HADTKTTIDKLAVMVAPNVGGEIDLSTTILTLGTGDAKYSLVYDSTQHNADV KDDGSDSIFDETEWGSGSKYGL
IVLQDSDN*(150)STAEATHPTINYGDKVYITVTMDVN*(175)STSKV SGEVIPDYGASGIVEFRAPS
VFTETVVTLQ
Sequence Around Glycosites (21 AA)
YGLIVLQDSDNSTAEATHPTI
KVYITVTMDVNSTSKVSGEVI
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Aberrant SDS-PAGE migration and glycan detection by MS
Technique(s) used for Glycosylated Residue(s) Detection
NanoLC–MS/MS (nano-liquid chromatography-electrospray tandem mass spectrometry)
Protein Glycosylation- Implication
Glycan is necessary for proper flagellar filament assembly and function. A minimal portion of the glycan (at least two sugars) is required to facilitate flagellar assembly and the presence of each additional sugar results in increased motility, as measured on semi-swarm plates.
 
 
Glycan Information
Glycan Annotation
Linkage: β-GalNAc-Asn.
N-linked tetrasaccharide (1036.4 Da) composed of N-acetylgalactosamine, di-acetylated glucuronic acid, an acetylated and acetamidino-modified mannuronic acid linked to threonine, and a novel terminal sugar: Sug-4-β-ManNAc3NAmA6Thr-4-β-GlcNAc3NAcA-3-β-GalNAc-Asn where Sug is a novel monosaccharide unit, (5S)-2-acetamido-2,4-dideoxy-5-O-methyl-α-L-erythro-hexos-5-ulo-1,5-pyranose.
BCSDB ID
Technique(s) used for Glycan Identification
NanoLC–MS/MS analysis and 1H, 13C NMR spectroscopy
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
aglB
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
AglB/STT3 subunit
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
>tr|Q6LXC8|Q6LXC8_METMP Oligosaccharyl transferase, STT3 subunit OS=Methanococcu
s maripaludis GN=MMP1424 PE=4 SV=1 MGEFLNKVSDFFKKNEKIKIILILLFIGMMSFQIRAQTADM
AFTDNSYLQDMFSDDNGRM YLTALDPYYYLRMTENYVNNDYSNVGETTVGIDGENIPYDTIQYAPPGREAGLVSA
LSIA TVLVYSVWNSIDSTVTIMNAAFWVPAIMSIFLGIPVFFIVRRNTASNIGGLVGALLLISS PSLLYKTSAG
FSDTPIFEILPLLFIVWMIMEAIHEQENSKKSGIFGGIAAILIGLYPMMW SGWWYAFDITAGFLVLYTAYEYLTK
SKNLKNVITTSLITLVGGAILVSLSTGLSGFINWI LSPIGFTVINEATKITGWPNVYMTVSELAIPTVTDIIENS
VGNIWLLIAGISGILLSFVS FKHDKQKIDIKYALYLTLWLIATVYAATKGIRFVALMTPALAIGIGIFAGQIENI
IKRYE KKVEYILYPVIGILSVITLIKYGGELFNILVPTTYVPIAVYLSIIALLVLAVYKIIDIIS EKEQAVKKV
FGILLAFMLVFPSMAAAVPFYTAPTMNNGWMDSLSWIKSETPENSVVTCWW DNGHIYTWATRKMVTFDGGSQNTP
RAYWVGHAFSTSDENLSVGILRMLATSGDSAYDDDS ILIKKTGSIKDTVDILNKILPLTRTEAKASLVNNYDLTD
AEAEEVLDLTHPKVTNPDYLI TYNRMTSIASVWSMFGNWNFSLPASTENSDREMGYYQQLGGSAQDINGTTVVYI
PLQETD SYRVINILEITDSEIKSANAVIDSNNQTSMQSPNFHKLILKVNGNVYEQETNENGDYSEI VRLEKLSD
GTYQVYAWVSSKNLEDSIYTKLHFLDGYGLEKISLEKESVDPTSYGIQPGFK VYSVDYGTDYLN
OST EC Number (BRENDA)
OST Genome Context
Characterized Accessory Gene(s)
AglO, AglA, AglL are glycosyltransferases responsible for tetrasaccharide assembly. AglO adds the second sugar, AglA adds the third sugar, and AglL transfers the last sugar. MMP0350 (acetyltransferase-second sugar ), MMP1081 (Acetamidino transfer-third sugar), MMP1085 (Methyltransferase-fourth sugar). MMP1081 and MMP1085 are unpublished results as referred in ref. 4.
Characterized by gene deletion studies.
PGL Additional Links
 
 
Literature
Reference(s)
1) Jarrell, K.F., Jones, G.M. and Nair, D.B. Biosynthesis and role of N-linked glycosylation in cell surface structures of archaea with a focus on flagella and s layers. Int J Microbiol, 2010, 470138. [PubMed: 20721273]
2) Kelly, J., Logan, S.M., Jarrell, K.F., VanDyke, D.J. and Vinogradov, E. (2009) A novel N-linked flagellar glycan from Methanococcus maripaludis. Carbohydr Res, 344, 648-653. [PubMed: 19203750]
3) VanDyke, D.J., Wu, J., Logan, S.M., Kelly, J.F., Mizuno, S., Aizawa, S. and Jarrell, K.F. (2009) Identification of genes involved in the assembly and attachment of a novel flagellin N-linked tetrasaccharide important for motility in the archaeon Methanococcus maripaludis. Mol Microbiol, 72, 633-644. [PubMed: 19400781]
4) VanDyke, D.J., Wu, J., Ng, S.Y., Kanbe, M., Chaban, B., Aizawa, S. and Jarrell, K.F. (2008) Identification of a putative acetyltransferase gene, MMP0350, which affects proper assembly of both flagella and pili in the archaeon Methanococcus maripaludis. J Bacteriol, 190, 5300-5307. [PubMed: 18539748]
Additional Comments
Sug, a novel monosaccharide unit, (5S)-2-acetamido-2,4-dideoxy-5-O-methyl-α-L-erythro-hexos-5-ulo-1,5-pyranose is the first example of a naturally occuring diglycoside of an aldulose.
Year of Identification
2008
Year of Validation
2009
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.