Total Record - 1

Print this rrecord

 
ProGlyProt ID
AC118
Organism Information
Organism Name
Pyrococcus furiosus DSM 3638
Domain
Archaea
Classification
Family: Thermococcaceae
Order: Thermococcales
Class: Thermococci or Protoarchaea
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
pls (PF0287)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Pyrolysin
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>sp|P72186|PLS_PYRFU Pyrolysin OS=Pyrococcus furiosus GN=pls PE=1 SV=2 MNKKGLTVL
FIAIMLLSVVPVHFVSAGTPPVSSENSTTSILPNQQVVTKEVSQAALNAIM KGQPNMVLIIKTKEGKLEEAKTEL
EKLGAEILDENRVLNMLLVKIKPEKVKELNYISSLE KAWLNREVKLSPPIVEKDVKTKEPSLEPKMYNSTWVINA
LQFIQEFGYDGSGVVVAVLDT GVDPNHPFLSITPDGRRKIIEWKDFTDEGFVDTSFSFSKVVNGTLIINTTFQVA
SGLTLN ESTGLMEYVVKTVYVSNVTIGNITSANGIYHFGLLPERYFDLNFDGDQEDFYPVLLVNST GNGYDIAY
VDTDLDYDFTDEVPLGQYNVTYDVAVFSYYYGPLNYVLAEIDPNGEYAVFGW DGHGHGTHVAGTVAGYDSNNDAW
DWLSMYSGEWEVFSRLYGWDYTNVTTDTVQGVAPGAQ IMAIRVLRSDGRGSMWDIIEGMTYAATHGADVISMSLG
GNAPYLDGTDPESVAVDELTEK YGVVFVIAAGNEGPGINIVGSPGVATKAITVGAAAVPINVGVYVSQALGYPDY
YGFYYFP AYTNVRIAFFSSRGPRIDGEIKPNVVAPGYGIYSSLPMWIGGADFMSGTSMATPHVSGVV ALLISGA
KAEGIYYNPDIIKKVLESGATWLEGDPYTGQKYTELDQGHGLVNVTKSWEILK AINGTTLPIVDHWADKSYSDFA
EYLGVDVIRGLYARNSIPDIVEWHIKYVGDTEYRTFEI YATEPWIKPFVSGSVILENNTEFVLRVKYDVEGLEPG
LYVGRIIIDDPTTPVIEDEILNT IVIPEKFTPENNYTLTWYDINGPEMVTHHFFTVPEGVDVLYAMTTYWDYGLY
RPDGMFVF PYQLDYLPAAVSNPMPGNWELVWTGFNFAPLYESGFLVRIYGVEITPSVWYINRTYLDTN TEFSIE
FNITNIYAPINATLIPIGLGTYNASVESVGDGEFFIKGIEVPEGTAELKIRIGN PSVPNSDLDLYLYDSKGNLVA
LDGNPTAEEEVVVEYPKPGVYSIVVHGYSVRDENGNPTT TTFDLVVQMTLDNGNIKLDKDSIILGSNESVVVTAN
ITIDRDHPTGVYSGIIEIRDNEVY QDTNTSIAKIPITLVIDKADFAVGLTPAEGVLGEARNYTLIVKHALTLEPV
PNATVIIGN YTYLTDENGTVTFTYAPTKLGSDEITVIVKKENFNTLEKTFQITVSEPEITEEDINEPKL AMSSP
EANATIVSVEMESEGGVKKTVTVEITINGTANETATIVVPVPKKAENIEVSGDHV ISYSIEEGEYAKYVIITVKF
ASPVTVTVTYTIYAGPRVSILTLNFLGYSWYRLYSQKFDE LYQKALELGVDNETLALALSYHEKAKEYYEKALEL
SEGNIIQYLGDIRLLPPLRQAYINE MKAVKILEKAIEELEGEE
Sequence length
1398 AA
Subcellular Location
Cell envelope associated
Function
Hyperthermostable serine protease. Has endopeptidase activity toward caseins, casein fragments including alpha-S1-casein and synthetic peptides. EC= 3.1.21.-
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
(Signal peptide: 1-26, propeptide: 26-149) N152
Experimentally Validated Glycosite(s ) in Mature Protein
N3
Glycosite(s) Annotated Protein Sequence
>sp|P72186|PLS_PYRFU Pyrolysin OS=Pyrococcus furiosus GN=pls PE=1 SV=2 MNKKGLTV
LFIAIMLLSVVPVHFVSAGTPPVSSENSTTSILPNQQVVTKEVSQAALNAIM KGQPNMVLIIKTKEGKLEEAKT
ELEKLGAEILDENRVLNMLLVKIKPEKVKELNYISSLE KAWLNREVKLSPPIVEKDVKTKEPSLEPKMYN*(1
52)
STWVINALQFIQEFGYDGSGVVVAVLDT GVDPNHPFLSITPDGRRKIIEWKDFTDEGFVDTSFSFSKVVN
GTLIINTTFQVASGLTLN ESTGLMEYVVKTVYVSNVTIGNITSANGIYHFGLLPERYFDLNFDGDQEDFYPVLL
VNST GNGYDIAYVDTDLDYDFTDEVPLGQYNVTYDVAVFSYYYGPLNYVLAEIDPNGEYAVFGW DGHGHGTH
VAGTVAGYDSNNDAWDWLSMYSGEWEVFSRLYGWDYTNVTTDTVQGVAPGAQ IMAIRVLRSDGRGSMWDIIEGM
TYAATHGADVISMSLGGNAPYLDGTDPESVAVDELTEK YGVVFVIAAGNEGPGINIVGSPGVATKAITVGAAAV
PINVGVYVSQALGYPDYYGFYYFP AYTNVRIAFFSSRGPRIDGEIKPNVVAPGYGIYSSLPMWIGGADFMSGTS
MATPHVSGVV ALLISGAKAEGIYYNPDIIKKVLESGATWLEGDPYTGQKYTELDQGHGLVNVTKSWEILK AI
NGTTLPIVDHWADKSYSDFAEYLGVDVIRGLYARNSIPDIVEWHIKYVGDTEYRTFEI YATEPWIKPFVSGSVI
LENNTEFVLRVKYDVEGLEPGLYVGRIIIDDPTTPVIEDEILNT IVIPEKFTPENNYTLTWYDINGPEMVTHHF
FTVPEGVDVLYAMTTYWDYGLYRPDGMFVF PYQLDYLPAAVSNPMPGNWELVWTGFNFAPLYESGFLVRIYGVE
ITPSVWYINRTYLDTN TEFSIEFNITNIYAPINATLIPIGLGTYNASVESVGDGEFFIKGIEVPEGTAELKIRI
GN PSVPNSDLDLYLYDSKGNLVALDGNPTAEEEVVVEYPKPGVYSIVVHGYSVRDENGNPTT TTFDLVVQMT
LDNGNIKLDKDSIILGSNESVVVTANITIDRDHPTGVYSGIIEIRDNEVY QDTNTSIAKIPITLVIDKADFAVG
LTPAEGVLGEARNYTLIVKHALTLEPVPNATVIIGN YTYLTDENGTVTFTYAPTKLGSDEITVIVKKENFNTLE
KTFQITVSEPEITEEDINEPKL AMSSPEANATIVSVEMESEGGVKKTVTVEITINGTANETATIVVPVPKKAEN
IEVSGDHV ISYSIEEGEYAKYVIITVKFASPVTVTVTYTIYAGPRVSILTLNFLGYSWYRLYSQKFDE LYQK
ALELGVDNETLALALSYHEKAKEYYEKALELSEGNIIQYLGDIRLLPPLRQAYINE MKAVKILEKAIEELEGEE
Sequence Around Glycosites (21 AA)
KEPSLEPKMYNSTWVINALQF
Technique(s) used for Glycosylation Detection
Periodic acid-Schiff (PAS) staining
Technique(s) used for Glycosylated Residue(s) Detection
Edman degradation
Protein Glycosylation- Implication
The post-translational modification may function in the thermostabilization of the enzyme.
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
aglB
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
AglB/STT3
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
>tr|Q8U4D2|Q8U4D2_PYRFU Oligosaccharyl transferase stt3 subunit related protein
OS=Pyrococcus furiosus GN=PF0156 PE=1 SV=1 MVKTQIKEKKKDEKVTIPLPGKIKTVLAFLVVL
AFAAYGFYIRHLTAGKYFSDPDTFYHF EIYKLVLKEGLPRYYPMADAPFGSLIGEPLGLYILPAIFYKIISIFGY
NELEAFLLWPPF VGFLSVIGVYLLGRKVLNEWAGMWGAIILSVLTANFSRTFSGNARGDGPFMMLFTFSAVL ML
YYLTEENKNKKIIWGTLFVLLAGISTAAWNGSPFGLMVLLGFASFQTIILFIFGKINE LREFIKEYYPAYLGILA
ISYLLTIPGIGKIGGFVRFAFEVFLGLVFLAIVMLYGGKYLNY SDKKHRFAVVAVIVIAGFAGAYIYVGPKLFTL
MGGAYQSTQVYETVQELAKTDWGDVKVY YGVEKPNGIVFFLGLVGAMIVTARYLYKLFKDGRRPHEELFAITFYV
MSIYLLWTAARFL FLASYAIALMSGVFAGYVLETVEKMKESIPIKAALGGVIAIMLLLIPLTHGPLLAQSAKS M
RTTEIETSGWEDALKWLRENTPEYSTATSWWDYGYWIESSLLGQRRASADGGHARDRDH ILALFLARDGNISEVD
FESWELNYFLVYLNDWAKFNAISYLGGAITRREYNGDESGRGAV TTLLPLPRYGEKYVNLYAKVIVDVSNSSVKV
TVGDRECDPLMVTFTPSGKTIKGTGTCSD GNAFPYVLHLTPTIGVLAYYKVATANFIKLAFGVPASTIPGFSDKL
FSNFEPVYESGNVI VYRFTPFGIYKIEENINGTWKQVYNLTPGKHELKLYISAFGRDIENATLYIYAINNEKII
EKIKIAEISHMDYLNEYPIAVNVTLPNATSYRFVLVQKGPIGVLLDAPKVNGEIRSPTNI LREGESGEIELKVGV
DKDYTADLYLRATFIYLVRKSGKDNEDYDAAFEPQMDVFFITKIG ENIQLKEGENTVKVRAELPEGVISSYKDEL
QRKYGDKLIIRGIRVEPVFIAEKEYLMLEV SASAPHH
OST PDB ID
2ZAI, 2ZAG
OST EC Number (BRENDA)
OST Genome Context
PGL Additional Links
 
 
Literature
Reference(s)
1) Igura, M. and Kohda, D. (2011) Selective control of oligosaccharide transfer efficiency for the N-glycosylation sequon by a point mutation in oligosaccharyltransferase. J Biol Chem, 286, 13255-13260. [PubMed: 21357684]
2) Igura, M., Maita, N., Kamishikiryo, J., Yamada, M., Obita, T., Maenaka, K. and Kohda, D. (2008) Structure-guided identification of a new catalytic motif of oligosaccharyltransferase. EMBO J, 27, 234-243. [PubMed: 18046457]
3) de Vos, W.M., Voorhorst, W.G., Dijkgraaf, M., Kluskens, L.D., Van der Oost, J. and Siezen, R.J. (2001) Purification, characterization, and molecular modeling of pyrolysin and other extracellular thermostable serine proteases from hyperthermophilic microorganisms. Methods Enzymol, 330, 383-393. [PubMed: 11210516]
4) Voorhorst, W.G., Eggen, R.I., Geerling, A.C., Platteeuw, C., Siezen, R.J. and Vos, W.M. (1996) Isolation and characterization of the hyperthermostable serine protease, pyrolysin, and its gene from the hyperthermophilic archaeon Pyrococcus furiosus. J Biol Chem, 271, 20426-20431. [PubMed: 8702780]
Year of Identification
1996
Year of Validation
1996
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.