Total Record - 1

Print this rrecord

 
ProGlyProt ID
AC119
Organism Information
Organism Name
Staphylothermus marinus F1
Domain
Archaea
Classification
Family: Desulfurococcaceae
Order: Desulfurococcales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
Smar_1008
 
 
Protein Information
Protein Name
Tetrabrachion (S layer glycoprotein)
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|Q54436|Q54436_STAMA Tetrabrachion OS=Staphylothermus marinus PE=1 SV=1 MNRVL
AYSLLAIMTLSLLIIPAPGIAQRITVGVSVKAGTYNFYNITPTTQTVEVTDNGML RVIINRTEATELGTTIRLAF
ILDTDKYDPNVGGYFLNVSNIGVYAPSDPTQSPYGGVIDI TQNSTLTDGTQVVGNVTVVNGGNNVIILIDLSKLP
DLQNVVYITNVYTETSTTANLTNTL LRVKAFDAASWDAVISGNQFKILYIPSLCKYVKINVIHSPAIVGTNVDVI
VSFHKYFSLV QSIAGVSLDITVDNKTQLNMTNYYNATENYVLATFINGNLTVGGSEVFSSPTVTVINAST FKYS
GQVKDYAPTVADTATPWVRTLNKFEVEFRHEIVNXTHDLIFYIHCDSDTVSYDTWP FLIVNASLDITTTEVAFNS
TTINPGDIVNFTAHNVPLQYLTATNYGVLRFQLINPALVVY VPVSNMTLSANTTTGIINGSFVLPDAPYGGLDYL
TYLVFNDGKFIANGYITVSPCIETYV LTNTSAYAEDAGSSYIGRFVPGYTSVPGDYIVIKGYGFALSNLTGFTVS
INNTDVIILNA TYNASTGKIIILAKLLDTNGTPIPVGAGFIRVGQNGTTNIAYAPFNVTRNSGLEKVLFNP RWF
YNGTYYIEHDKLGDPYLYFPVDYPLVNNTFTTEMWPFNTTIEVIGWPTNTFTLKAFN KEFNLSFNLLTLSLTNGY
NMTNLYNLTIPFLPYGNYTLLEGTLLSVNNRTVFTVHMGINV DLDSCGNGTLSITVVGAAPNTEYNFTFGYQVHD
LNYGITRYISPQWNGTWNISLVTDIYG TGSTSVPLITLYPTSYVINATWDVITWLRLSGSGTLDLLFSVDVSYNG
FTDNLTTPITYV FGPSDTTPGSFNIYVNTTYNVSVVRVAVDYLPRTNVVISVPETVLPGDTITVQIFPHHNE VW
GFIEPTALFDENQLLGWYLTVRLVDPLSNTVVERVAGYYAGNLIVEDVDGDGDNEVWF VVNLTAPLVLGVDKTYR
VDVELFLAVLNPSSNITGVTAVDNECYVQLDLNGTIYWNGLGS GIMLGGDGQIVTVLGVLEGKLDTIKDGIAEIN
ATVNDINTYLKVNVTDLLKTINNSVVMI KNDTATLIIGQAEIKAKLDDLLNLTSQVNDTVTMILACCNNASKVLN
RMEGTLNSTYTGV LNVKSDLSTLIDTANNVVIPKFNELYDNVTVEINASRDLIIQKISSVNDSLTTIISAGFN D
VEAMISNLNTTLLNRIDELEGTLLFYMTANEQRLEGIINETADDIVYRLTVIIDDRYES LKNLITLRADRLEMII
NDNVSTILASIGNVNLTVFNKLNDLEIELGDVNATINAGIFQIQ SNLGNANQLILDTLTSSKVEILNAISSNASA
ISSEIHNAVNQLSTLVLQVNDTLTLKITG EADNILNFLSSLEGSMNTGFNNVTSTLSAVENNILGKITDTSNLLS
SKIDNTLSTLQDLI TSTSNDLKNSISSAKNDIVSSLSSKVDSSTQTLSTKLDDLKSAQESNTNSINNNIMLFGA
ASLILLIVTIGLVGYRLIARRRVG
Sequence length
1524 AA
Subcellular Location
Surface (anchored in the membrane at one end)
Function
Structural unit of S layer making it stable towards extremely harsh conditions. Encoded as a precursor with 26 AA signal peptide.
 
 
Protein Structure
PDB ID
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked (O Ser/Thr- linked residues not yet identified)
Experimentally Validated Glycosite(s) in Full Length Protein
N44, N605, N641, N685, N708, N1279, N1402
Experimentally Validated Glycosite(s ) in Mature Protein
N44, N605, N641, N685, N708, N1279, N1402
Glycosite(s) Annotated Protein Sequence
>tr|Q54436|Q54436_STAMA Tetrabrachion OS=Staphylothermus marinus PE=1 SV=1 MNRV
LAYSLLAIMTLSLLIIPAPGIAQRITVGVSVKAGTYNFYN*(44)ITPTTQTVEVTDNGML RVIINRTEATE
LGTTIRLAFILDTDKYDPNVGGYFLNVSNIGVYAPSDPTQSPYGGVIDI TQNSTLTDGTQVVGNVTVVNGGNNV
IILIDLSKLPDLQNVVYITNVYTETSTTANLTNTL LRVKAFDAASWDAVISGNQFKILYIPSLCKYVKINVIHS
PAIVGTNVDVIVSFHKYFSLV QSIAGVSLDITVDNKTQLNMTNYYNATENYVLATFINGNLTVGGSEVFSSPTV
TVINAST FKYSGQVKDYAPTVADTATPWVRTLNKFEVEFRHEIVNXTHDLIFYIHCDSDTVSYDTWP FLIVN
ASLDITTTEVAFNSTTINPGDIVNFTAHNVPLQYLTATNYGVLRFQLINPALVVY VPVSNMTLSANTTTGIING
SFVLPDAPYGGLDYLTYLVFNDGKFIANGYITVSPCIETYV LTNTSAYAEDAGSSYIGRFVPGYTSVPGDYIVI
KGYGFALSNLTGFTVSINNTDVIILNA TYNASTGKIIILAKLLDTNGTPIPVGAGFIRVGQNGTTNIAYAPFNV
TRNSGLEKVLFNP RWFYN*(605)GTYYIEHDKLGDPYLYFPVDYPLVNNTFTTEMWPFN*(641)TTIE
VIGWPTNTFTLKAFN KEFNLSFNLLTLSLTNGYNMTNLYN*(685)LTIPFLPYGNYTLLEGTLLSVNN*(
708)
RTVFTVHMGINV DLDSCGNGTLSITVVGAAPNTEYNFTFGYQVHDLNYGITRYISPQWNGTWNISLVTD
IYG TGSTSVPLITLYPTSYVINATWDVITWLRLSGSGTLDLLFSVDVSYNGFTDNLTTPITYV FGPSDTTPG
SFNIYVNTTYNVSVVRVAVDYLPRTNVVISVPETVLPGDTITVQIFPHHNE VWGFIEPTALFDENQLLGWYLTV
RLVDPLSNTVVERVAGYYAGNLIVEDVDGDGDNEVWF VVNLTAPLVLGVDKTYRVDVELFLAVLNPSSNITGVT
AVDNECYVQLDLNGTIYWNGLGS GIMLGGDGQIVTVLGVLEGKLDTIKDGIAEINATVNDINTYLKVNVTDLLK
TINNSVVMI KNDTATLIIGQAEIKAKLDDLLNLTSQVNDTVTMILACCNNASKVLNRMEGTLNSTYTGV LNV
KSDLSTLIDTANNVVIPKFNELYDNVTVEINASRDLIIQKISSVNDSLTTIISAGFN DVEAMISNLNTTLLNRI
DELEGTLLFYMTANEQRLEGIINETADDIVYRLTVIIDDRYES LKNLITLRADRLEMIINDN*(1279)VST
ILASIGNVNLTVFNKLNDLEIELGDVNATINAGIFQIQ SNLGNANQLILDTLTSSKVEILNAISSNASAISSEI
HNAVNQLSTLVLQVNDTLTLKITG EADNILNFLSSLEGSMNTGFNN*(1402)VTSTLSAVENNILGKITDT
SNLLSSKIDNTLSTLQDLI TSTSNDLKNSISSAKNDIVSSLSSKVDSSTQTLSTKLDDLKSAQESNTNSINNNI
MLFGA ASLILLIVTIGLVGYRLIARRRVG
Sequence Around Glycosites (21 AA)
SVKAGTYNFYNITPTTQTVEV
KVLFNPRWFYNGTYYIEHDKL
NTFTTEMWPFNTTIEVIGWPT
TNGYNMTNLYNLTIPFLPYGN
LLEGTLLSVNNRTVFTVHMGI
ADRLEMIINDNVSTILASIGN
LEGSMNTGFNNVTSTLSAVEN
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Carbohydrate analysis using trifluoroacetic acid and GC/MS (gas chromatography/mass spectrometry).
Technique(s) used for Glycosylated Residue(s) Detection
Edman degradation
 
 
Glycan Information
Glycan Annotation
Carbohydrates present: glucose, mannose, and glucosamine. Both N and O linked glycans present.
β-elimination revealed that at least 15 carbohydrate chains are bound to Ser or Thr. Two molecules of 150 KDa proteases are associated with glycosylated tetrabrachion polypeptides (85 KDa & 92KDa) and for this tetrabrachion-protease complex overall carbohydrate content is 38%.
 
 
Protein Glycosylation linked (PGL) gene(s)
Characterized Accessory Gene(s)
Information currently not available with us.
PGL Additional Links
 
 
Literature
Reference(s)
1) Ozbek, S., Muller, J.F., Figgemeier, E. and Stetefeld, J. (2005) Favourable mediation of crystal contacts by cocoamidopropylbetaine (CAPB). Acta Crystallogr D Biol Crystallogr, 61, 477-480. [PubMed: 15805603]
2) Stetefeld, J., Jenny, M., Schulthess, T., Landwehr, R., Engel, J. and Kammerer, R.A. (2000) Crystal structure of a naturally occurring parallel right-handed coiled coil tetramer. Nat Struct Biol, 7, 772-776. [PubMed: 10966648]
3) Peters, J., Baumeister, W. and Lupas, A. (1996) Hyperthermostable surface layer protein tetrabrachion from the archaebacterium Staphylothermus marinus: evidence for the presence of a right-handed coiled coil derived from the primary structure. J Mol Biol, 257, 1031-1041. [PubMed: 8632466]
4) Peters, J., Nitsch, M., Kuhlmorgen, B., Golbik, R., Lupas, A., Kellermann, J., Engelhardt, H., Pfander, J.P., Muller, S., Goldie, K. et al. (1995) Tetrabrachion: a filamentous archaebacterial surface protein assembly of unusual structure and extreme stability. J Mol Biol, 245, 385-401. [PubMed: 7837271]
Year of Identification
1995
Year of Validation
1996
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.