Total Record - 1

Print this rrecord

 
ProGlyProt ID
AC121
Organism Information
Organism Name
Sulfolobus acidocaldarius (DSM 639)
Domain
Archaea
Classification
Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
slaA (Saci_2355) or slp1
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
SlaA (S- layer protein)
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>tr|Q4J6E5|Q4J6E5_SULAC Conserved protein OS=Sulfolobus acidocaldarius GN=Saci_2
355 PE=4 SV=1 MNKLVGLLVSSLFLASILIGIAPAITTTALTPPVSAGGIQAYLLTGSGAPASGLVLFVVN V
SNIQVSSSNVTNVISTVVSNIQINAKTENAQTGATTGSVTVRFPTSGYNAYYDSVDKVV FVVVSFLYPYTTTSVN
IPLSYLSKYLPGLLTAQPYDETGAQVTSVSSTPFGSLIDTSTGQ QILGTNPVLTSYNSYTTQANTNMQEGVVSGT
LTSFTLGGQSFSGSTVPVILYAPFIFSNS PYQAGLYNPMQVNGNLGSLSSEAYYHPVIWGRALINTTLIDTYASG
SVPFTFQLNYSVPG PLTINMAQLAWIASINNLPTSFTYLSYKFSNGYESFLGIISNSTQLTAGALTINPSGNFT
INGKKFYVYLLVVGSTNSTTPVEYVTKLVVEYPSSTNFLPQGVTVTTSSNKYTLPVYEIG GPAGTTITLTGNWYS
TPYTVQITVGSTPTLTNYVSQILLKAVAYEGINVSTTQSPYYSTA ILSTPPSEISITGSSTITAQGKLTATSASA
TVNLLTNATLTYENIPLTQYSFNGIIVTPG YAAINGTTAMAYVIGALYNKTSDYVLSFAGSQEPMQVMNNNLTEV
TTLAPFGLTLLAPSV PATETGTSPLQLEFFTVPSTSYIALVDFGLWGNLTSVTVSAYDTVNNKLSVNLGYFYGIV
IPPSISTAPYNYQNFICPNNYVTVTIYDPDAVLDPYPSGSFTTSSLPLKYGNMNITGAVI FPGSSVYNPSGVFG
YSNFNKGAAVTTFTYTAQSGPFSPVALTGNTNYLSQYADNNPTDNY YFIQTVNGMPVLMGGLSIVASPVSASLPS
STSSPGFMYLLPSAAQVPSPLPGMATPNYNL NIYITYKIDGATVGNNMINGLYVASQNTLIYVVPNGSFVGSNIK
LTYTTTDYAVLHYFYS TGQYKVFKTVSVPNVTANLYFPSSTTPLYQLSVPLYLSEPYYGSPLPTYIGLGTNGTSL
W NSPNYVLFGVSAVQQYLGFIKSISVTLSNGTTVVIPLTTSNMQTLFPQLVGQELQACNGT FQFGISITGLEKL
LNLNVQQLNNSILSVTYHDYVTGETLTATTKLVALSTLSLVAKGAGV VEFLLTAYPYTGNITFAPPWFIAENVVK
QPFMTYSDLQFAKTNPSAILSLSTVNITVVGL GGKASVYYNSTSGQTVITNIYGQTVATLSGNVLPTLTELAAGN
GTFTGSLQFTIVPNNTV VQIPSSLTKTSFAVYTNGSLAIVLNGKAYSLGPAGLFLLPFVTYTGSAIGANATAIIT
VS DGVGTSTTQVPITAENFTPIRLAPFQVPAQVPLPNAPKLKYEYNGSIVITPQQQVLKIYV TSILPYPQEFQI
QAFVYEASQFNVHTGSPTAAPVYFSYSAVRAYPALGIGTSVPNLLVYV QLQGISNLPAGKYVIVLSAVPFAGGPV
LSEYPAQLIFTNVTLTQ
Sequence length
1424 AA
Subcellular Location
Surface
Function
The S-layer has to maintain the cell integrity and stabilize as well as protect the cell against mechanical and osmotic stresses or extreme pH conditions. It is also predicted that the S-layer has to maintain or even determine the cell shape.
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
(Signal peptide : 1-29) N1042, N1093, N1134, N1197, N1217, N1252, N1276, N1304, N1419
Experimentally Validated Glycosite(s ) in Mature Protein
N1013, N1064, N1105, N1168, N1188, N1223, N1247, N1275, N1390
Glycosite(s) Annotated Protein Sequence
>tr|Q4J6E5|Q4J6E5_SULAC Conserved protein OS=Sulfolobus acidocaldarius GN=Saci_2
355 PE=4 SV=1 MNKLVGLLVSSLFLASILIGIAPAITTTALTPPVSAGGIQAYLLTGSGAPASGLVLFVVN
VSNIQVSSSNVTNVISTVVSNIQINAKTENAQTGATTGSVTVRFPTSGYNAYYDSVDKVV FVVVSFLYPYTTT
SVNIPLSYLSKYLPGLLTAQPYDETGAQVTSVSSTPFGSLIDTSTGQ QILGTNPVLTSYNSYTTQANTNMQEGV
VSGTLTSFTLGGQSFSGSTVPVILYAPFIFSNS PYQAGLYNPMQVNGNLGSLSSEAYYHPVIWGRALINTTLID
TYASGSVPFTFQLNYSVPG PLTINMAQLAWIASINNLPTSFTYLSYKFSNGYESFLGIISNSTQLTAGALTINP
SGNFT INGKKFYVYLLVVGSTNSTTPVEYVTKLVVEYPSSTNFLPQGVTVTTSSNKYTLPVYEIG GPAGTTI
TLTGNWYSTPYTVQITVGSTPTLTNYVSQILLKAVAYEGINVSTTQSPYYSTA ILSTPPSEISITGSSTITAQG
KLTATSASATVNLLTNATLTYENIPLTQYSFNGIIVTPG YAAINGTTAMAYVIGALYNKTSDYVLSFAGSQEPM
QVMNNNLTEVTTLAPFGLTLLAPSV PATETGTSPLQLEFFTVPSTSYIALVDFGLWGNLTSVTVSAYDTVNNKL
SVNLGYFYGIV IPPSISTAPYNYQNFICPNNYVTVTIYDPDAVLDPYPSGSFTTSSLPLKYGNMNITGAVI F
PGSSVYNPSGVFGYSNFNKGAAVTTFTYTAQSGPFSPVALTGNTNYLSQYADNNPTDNY YFIQTVNGMPVLMGG
LSIVASPVSASLPSSTSSPGFMYLLPSAAQVPSPLPGMATPNYNL NIYITYKIDGATVGNNMINGLYVASQNTL
IYVVPNGSFVGSNIKLTYTTTDYAVLHYFYS TGQYKVFKTVSVPNVTANLYFPSSTTPLYQLSVPLYLSEPYYG
SPLPTYIGLGTNGTSLW NSPNYVLFGVSAVQQYLGFIKSISVTLSNGTTVVIPLTTSNMQTLFPQLVGQELQAC
NGT FQFGISITGLEKLLNLNVQQLN*(1042)NSILSVTYHDYVTGETLTATTKLVALSTLSLVAKGAGV
VEFLLTAYPYTGN*(1093)ITFAPPWFIAENVVKQPFMTYSDLQFAKTNPSAILSLSTVN*(1134)ITVV
GL GGKASVYYNSTSGQTVITNIYGQTVATLSGNVLPTLTELAAGNGTFTGSLQFTIVPN*(1197)NTV V
QIPSSLTKTSFAVYTN*(1217)GSLAIVLNGKAYSLGPAGLFLLPFVTYTGSAIGAN*(1252)ATAIITV
S DGVGTSTTQVPITAEN*(1276)FTPIRLAPFQVPAQVPLPNAPKLKYEYN*(1304)GSIVITPQQQV
LKIYV TSILPYPQEFQIQAFVYEASQFNVHTGSPTAAPVYFSYSAVRAYPALGIGTSVPNLLVYV QLQGISN
LPAGKYVIVLSAVPFAGGPVLSEYPAQLIFTN*(1419)VTLTQ
Sequence Around Glycosites (21 AA)
KLLNLNVQQLNNSILSVTYHD
FLLTAYPYTGNITFAPPWFIA
PSAILSLSTVNITVVGLGGKA
TGSLQFTIVPNNTVVQIPSSL
LTKTSFAVYTNGSLAIVLNGK
VTYTGSAIGANATAIITVSDG
STTQVPITAENFTPIRLAPFQ
PNAPKLKYEYNGSIVITPQQQ
SEYPAQLIFTNVTLTQ
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Glycan identification by nano-LC-MS/MS
Technique(s) used for Glycosylated Residue(s) Detection
In-gel tryptic digestion and nano-LC-ES-MS/MS (nano-liquid chromatography-electrospray tandem mass spectrometry)
Protein Glycosylation- Implication
Glycosylation of S layer protein might contribute towards increased stability and half-life of S layer structural proteins in extreme thermoacidic environments.
 
 
Glycan Information
Glycan Annotation
Linkage: β-GlcNAc-Asn.
N-linked hexasaccharide units - two residues each of Man and GlcNAc (one trisubstituted) and one residue each of Glc and 6-deoxy-6-sulfoglucose (6-sulfoquinovose, QuiS - a rare acidic sugar). β-D-Glcp-(1→4)-β-D-Quip(6--SO3-)-(1→3)-[α-D-Manp(1→4), α-D-Manp(1→6)] β-D-GlcpNAc-(1→4)-β-D-GlcpNAc-(1→Asn....
Microheterogeneity is observed as a family of glycans modify each of the glycosylation sites. The glycans are linked via a chitobiose core.
BCSDB ID
Technique(s) used for Glycan Identification
GC-MS of trimethylsilyl (TMS) methyl glycoside derivatives and nano-LC-ESMS analysis
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
Saci_1274
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
Conserved membrane protein
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
>tr|Q4J9B4|Q4J9B4_SULAC Conserved membrane protein OS=Sulfolobus acidocaldarius
GN=Saci_1274 PE=4 SV=1 MQSTSILARIDKFKFLDAIIIGSLALFSILIRIISITAFPQTINGFDSWYLFY
NALLIVK AGGNWYAVPPDVHAWFPWGYFIELENTIGLPFLVALFSVPFYSIFGQNIVYTLTLVSPIV LDGIGVV
AAFLAVESITNSRVGGYIAAAITAFTPSLTYKNILGSLPKTSWGGVFVLFTIY FLSLAIKKKKPLYGIPAGIMIF
LANITWGGYTYIDISLAIAAFLIVLFNKNDEISAKTLT ISGITAAFLTSLSPNTIGFMSEVAHGLALLIIPLFLY
LDLYLRRVLPKDIVDSKNIVIGA AIILLVSLVVLGSVAFKVQLIPSRYYAIINPFFQFTVPIDRTVAEYIPQSIA
AMIQDFGI GLFLSIIGIYFLLTRKQDMAGIWLVVLGAASIYGTSEQPYLFNYTIYIVAALAGVAVAEL FSRFME
RKIRIAPILMLTLIGVALLADAGIAVEASYAPQALINSSTSYLTTNYAWISALD WINQNTPNNAFILSWWDYGYW
IHAVGNRTVIDENNTLNGTQIKLMAEMFLNNESFAVNVL ENDFHLYPYGNPNYTRPVYIVAYDAVTEYIVNNQYP
VWFIGYPTNFPGTFIGYTTSLGDI AKAIGAMTTIAGYNTNSYVNTTYINETASYAAQYNSQLASIIANSLPMAWT
PKTYNSLIG SMFIEAIQSLNQGPVQAPFSISLSQLLQSSSTSLYNPNALLPRVNLMYFKPVYIALFPLS VTNAL
GGEAIVYIMVYIYQFVMPNVIIPPTISTA
OST EC Number (BRENDA)
OST Genome Context
PGL Additional Links
 
 
Literature
Reference(s)
1) Peyfoon, E., Meyer, B., Hitchen, P.G., Panico, M., Morris, H.R., Haslam, S.M., Albers, S.V. and Dell, A. (2010) The S-layer glycoprotein of the crenarchaeote Sulfolobus acidocaldarius is glycosylated at multiple sites with chitobiose-linked N-glycans. Archaea, 2010. [PubMed: 20936123]
2) Veith, A., Klingl, A., Zolghadr, B., Lauber, K., Mentele, R., Lottspeich, F., Rachel, R., Albers, S.V. and Kletzin, A. (2009) Acidianus, Sulfolobus and Metallosphaera surface layers: structure, composition and gene expression. Mol Microbiol, 73, 58-72. [Pubmed 19522740]
3) Grogan, D.W. (1996) Organization and interactions of cell envelope proteins of the extreme thermoacidophile Sulfolobus acidocaldarius. Can J Microbiol, 42, 1163-1171.
4) Grogan, D.W. (1989) Phenotypic characterization of the archaebacterial genus Sulfolobus: comparison of five wild-type strains. J Bacteriol, 171, 6710-6719. [PubMed: 2512283]
Additional Comments
Similar to eukaryotes and unlike other archaea, the tribranched glycan is linked via chitobiose core (GlcNAcβ1-4GlcNAc) to the Asn in S. acidocaldarius glycoproteins. Hence Sulfolobus has been suggested as closest eukaryotic model for N glycosylation studies among archaeal speceis.
The glycosylation density at C terminus of the protein averages around 1 site per 30-40 residues.
Similarity found in glycan sequence in SlaA and cytochrome b558/566 subunit A strengthen the existing understanding of conservation of N glycosylation in a given species in archaea.
The glycosylation was detected in other strains by thymol-sulfuric acid staining and DIG-glycan detection by 1996 (Ref. no. 3).
Year of Identification
2010
Year of Validation
2010
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.