Total Record - 1

Print this rrecord

 
ProGlyProt ID
AC122
Organism Information
Organism Name
Sulfolobus acidocaldarius (DSM 639)
Domain
Archaea
Classification
Family: Sulfolobaceae
Order: Sulfolobales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
 
 
Gene Information
Gene Name
thpS (Saci_1714)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Thermopsin
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
340 AA
Subcellular Location
Secreted
Function
Thermostable acid protease. It has maximal proteolytic activity at pH 2 and 90 “C.Belongs to the peptidase A5 family. EC= 3.4.23.42.
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
(Signal peptide: 1-28, Propeptide: 28-41) N65, N69
Experimentally Validated Glycosite(s ) in Mature Protein
N24, N28
Glycosite(s) Annotated Protein Sequence
>sp|P17118|THPS_SULAC Thermopsin OS=Sulfolobus acidocaldarius GN=thpS PE=1 SV=1
MNFKSICLIILLSALIIPYIPQNIYFFPHRNTTGATISSGLYVNPYLYYTSPPAPAGIAS FGLYN*(65)Y
SGN*(69)VTPYVITTNEMLGYVNITSLLAYNREALRYGVDPYSATLQFNIVLSVNTSN GVYAYWLQDVGQF
QTNKNSLTFIDNVWNLTGSLSTLSSSAITGNGQVASAGGGQTFYYDV GPSYTYSFPLSYIYIINMSYTSNAVYV
WIGYEIIQIGQTEYGTVNYYDKITIYQPNIISA SLMINGNNYTPNGLYYDAELVWGGGGNGAPTSFNSLNCTLG
LYYISNGSITPVPSLYTFG ADTAEAAYNVYTTMNNGVPIAYNGIENLTILTNNFSVILI
Sequence Around Glycosites (21 AA)
PAGIASFGLYNYSGNVTPYVI
ASFGLYNYSGNVTPYVITTNE
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Aberrant SDS-PAGE migration.
Technique(s) used for Glycosylated Residue(s) Detection
Edman degradation
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
Saci_1274
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
Conserved membrane protein
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
>tr|Q4J9B4|Q4J9B4_SULAC Conserved membrane protein OS=Sulfolobus acidocaldarius
GN=Saci_1274 PE=4 SV=1 MQSTSILARIDKFKFLDAIIIGSLALFSILIRIISITAFPQTINGFDSWYLFY
NALLIVK AGGNWYAVPPDVHAWFPWGYFIELENTIGLPFLVALFSVPFYSIFGQNIVYTLTLVSPIV LDGIGVV
AAFLAVESITNSRVGGYIAAAITAFTPSLTYKNILGSLPKTSWGGVFVLFTIY FLSLAIKKKKPLYGIPAGIMIF
LANITWGGYTYIDISLAIAAFLIVLFNKNDEISAKTLT ISGITAAFLTSLSPNTIGFMSEVAHGLALLIIPLFLY
LDLYLRRVLPKDIVDSKNIVIGA AIILLVSLVVLGSVAFKVQLIPSRYYAIINPFFQFTVPIDRTVAEYIPQSIA
AMIQDFGI GLFLSIIGIYFLLTRKQDMAGIWLVVLGAASIYGTSEQPYLFNYTIYIVAALAGVAVAEL FSRFME
RKIRIAPILMLTLIGVALLADAGIAVEASYAPQALINSSTSYLTTNYAWISALD WINQNTPNNAFILSWWDYGYW
IHAVGNRTVIDENNTLNGTQIKLMAEMFLNNESFAVNVL ENDFHLYPYGNPNYTRPVYIVAYDAVTEYIVNNQYP
VWFIGYPTNFPGTFIGYTTSLGDI AKAIGAMTTIAGYNTNSYVNTTYINETASYAAQYNSQLASIIANSLPMAWT
PKTYNSLIG SMFIEAIQSLNQGPVQAPFSISLSQLLQSSSTSLYNPNALLPRVNLMYFKPVYIALFPLS VTNAL
GGEAIVYIMVYIYQFVMPNVIIPPTISTA
OST EC Number (BRENDA)
OST Genome Context
PGL Additional Links
 
 
Literature
Reference(s)
1) Lin, X. and Tang, J. (1990) Purification, characterization, and gene cloning of thermopsin, a thermostable acid protease from Sulfolobus acidocaldarius. J Biol Chem, 265, 1490-1495. [PubMed: 2104843]
Year of Identification
1990
Year of Validation
1990
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.