Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC101
Organism Information
Organism Name
Thermoanaerobacter kivui (Acetogenium kivui)
Domain
Bacteria
Classification
Family: Thermoanaerobacteraceae
Order: Thermoanaerobacterales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Protein Information
Protein Name
Cell surface protein/ S-layer protein
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>sp|P22258|SLAP_ACEKI Cell surface protein OS=Acetogenium kivui PE=1 SV=1 MKNLKK
LIAVVSTFALVFSAMAVGFAATTPFTDVKDDAPYASAVARLYALNITNGVGDPK FGVDQPVTRAQMITFVNRMLG
YEDLAEMAKSEKSAFKDVPQNHWAVGQINLAYKLGLAQG VGNGKFDPNSELRYAQALAFVLRALGFKDLDWPYGY
LAKAQDLGLVHGLNLAYNGVIKRG DLALILDRALEVPMVKYVDGKEVLGEPLISKVATKAEYTVIATNAQDRSVE
EGKVAVLDK DGKLTTINAGLVDFSEYLGKKVIVYSERFGDPVYVAEGDNDVVSFTEGQDSVGTTVYKND DNKTA
IKVDDNAYVLYNGYLTKVSKVTVKEGAEVTIINNNYLIVNGSYDNSTIVYNDVQS GDKYLNRDSNYELKGTVTVT
GAVSKVTDIKANDYIYYGKQYDVNGNVVGTVIYVVRNQVT GTVTEKSVSGSTYKASIDNVSYTVADNNVWNQLEP
GKKVTVILNKDNVIVGISSTTTTTA VNYAIFKEKSDPFTAWFAKVKLILPDAAEKVFDAVYSDVYDKVNLAEGTI
VTYTVDANGK LNDIQRANDQPFSSASYKADAKVLTEGSTTYYITDNTVLLNNTSDGYKALKLTDLKDATN LNVK
IVADNYNVAKVVVFNNASFVSTTTSTVYAYVTGTADVYVNGSTFTRLTVLENGQTK TYDANAQLATNYTHKAVVL
TLTNAKIANIALPTVASGVKLTNIDQANLRITDTTNKGYLL DPNFIVVDTNGNLKGLSDITKDTGVNLYTNDVGK
VFVIEIVQ
Sequence length
762 AA
Subcellular Location
Surface
Function
The S-layer is a paracrystalline mono-layered assembly of proteins which coat the surface of bacteria. This bacterium is covered by a S-layer with hexagonal symmetry.
 
 
Glycosylation Status
Glycosylation Type
O (Tyr) linked
Experimentally Validated Glycosite(s) in Full Length Protein
Y297, Y516, Y520, Y632
Experimentally Validated Glycosite(s ) in Mature Protein
Y297, Y516, Y520, Y632
Glycosite(s) Annotated Protein Sequence
>sp|P22258|SLAP_ACEKI Cell surface protein OS=Acetogenium kivui PE=1 SV=1 MKNLK
KLIAVVSTFALVFSAMAVGFAATTPFTDVKDDAPYASAVARLYALNITNGVGDPK FGVDQPVTRAQMITFVNRM
LGYEDLAEMAKSEKSAFKDVPQNHWAVGQINLAYKLGLAQG VGNGKFDPNSELRYAQALAFVLRALGFKDLDWP
YGYLAKAQDLGLVHGLNLAYNGVIKRG DLALILDRALEVPMVKYVDGKEVLGEPLISKVATKAEYTVIATNAQD
RSVEEGKVAVLDK DGKLTTINAGLVDFSEYLGKKVIVYSERFGDPVYVAEGDNDVVSFTEGQDSVGTTVY*(2
97)
KND DNKTAIKVDDNAYVLYNGYLTKVSKVTVKEGAEVTIINNNYLIVNGSYDNSTIVYNDVQS GDKYL
NRDSNYELKGTVTVTGAVSKVTDIKANDYIYYGKQYDVNGNVVGTVIYVVRNQVT GTVTEKSVSGSTYKASIDN
VSYTVADNNVWNQLEPGKKVTVILNKDNVIVGISSTTTTTA VNYAIFKEKSDPFTAWFAKVKLILPDAAEKVFD
AVY*(516)SDVY*(520)DKVNLAEGTIVTYTVDANGK LNDIQRANDQPFSSASYKADAKVLTEGSTTY
YITDNTVLLNNTSDGYKALKLTDLKDATN LNVKIVADNYNVAKVVVFNNASFVSTTTSTVY*(632)AYVTG
TADVYVNGSTFTRLTVLENGQTK TYDANAQLATNYTHKAVVLTLTNAKIANIALPTVASGVKLTNIDQANLRIT
DTTNKGYLL DPNFIVVDTNGNLKGLSDITKDTGVNLYTNDVGKVFVIEIVQ
Sequence Around Glycosites (21 AA)
EGQDSVGTTVYKNDDNKTAIK
DAAEKVFDAVYSDVYDKVNLA
KVFDAVYSDVYDKVNLAEGTI
SFVSTTTSTVYAYVTGTADVY
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Deglycosylation (trifluoromethanesulfonic acid), aberrant migration on SDS-PAGE.
Technique(s) used for Glycosylated Residue(s) Detection
Protease digestion and glycopeptide separation by molecular sieve chromatography and reversed-phase HPLC. Deglycosylated and undeglycosylated peptides were run on 2D PAGE and subjected to N-terminal sequencing post blotting.
Protein Glycosylation- Implication
An N terminal SLH sequence of A. kivui S layer glycoprotein is suggested to fold independently and present itself in a modular way that may serve as an anchor to the peptidoglycan. Glycosylated residues are surface exposed and implicated in protease K resistance.
 
 
Glycan Information
Glycan Annotation
Carbohydrate content 8% corresponding to 40 to 50 sugar molecules per protein monomer. Acidic, repetitive heterogenous glycans of varying length containing N-acetylglucosamine, 1,6 linked glucose, 1,4 linked galactosamine and/or unidentified sugar-related component.
Technique(s) used for Glycan Identification
Hydrazinolysis followed by amino-acid analysis as well as two-dimensional NMR spectroscopy
 
 
Literature
Reference(s)
1) Lupas, A., Engelhardt, H., Peters, J., Santarius, U., Volker, S. and Baumeister, W. (1994) Domain structure of the Acetogenium kivui surface layer revealed by electron crystallography and sequence analysis. J Bacteriol, 176, 1224-1233. [PubMed: 8113161]
2) Peters, J., Rudolf, S., Oschkinat, H., Mengele, R., Sumper, M., Kellermann, J., Lottspeich, F. and Baumeister, W. (1992) Evidence for tyrosine-linked glycosaminoglycan in a bacterial surface protein. Biol Chem Hoppe Seyler, 373, 171-176. [PubMed: 1596358]
3) Peters, J., Peters, M., Lottspeich, F., Baumeister, W.(1989) S-layer protein gene of Acetogenium kivui: cloning and expression in Escherichia coli and determination of the nucleotide sequence. J Bacteriol, 171, 6307-6315. [PubMed: 2681162]
Additional Comments
A new recognition sequence for tyrosine linked glycosylation in Thermoanaerobacter kivui is suggested based on the fact that all glycosylated tyrosine in the sequence are preceded by valine.
Year of Identification
1989
Year of Validation
1992
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.