Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC102
Organism Information
Organism Name
Acidovorax (Pseudomonas) avenae K1 (H8301)
Domain
Bacteria
Classification
Family: Comamonadaceae
Order: Burkholderiales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
Organism Additional Information
Acidovorax avenae is a Gram-negative phytopathogenic bacterium. It is the causal agent of a seedling disease wherein brown stripes are formed on the sheaths of infected plants. This species has a broad host range among monocots while one or a few host species are infected by individual strains.
 
 
Gene Information
Gene Name
flaA
 
 
Protein Information
Protein Name
Flagellin
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
Sequence length
492 AA
Subcellular Location
Surface
Function
Flagellin structural protein.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein
S178, S183, S212, T351
Experimentally Validated Glycosite(s ) in Mature Protein
S178, S183, S212, T351
Glycosite(s) Annotated Protein Sequence
>tr|Q9FAE7|Q9FAE7_9BURK Flagellin OS=Acidovorax avenae subsp. avenae GN=H8301-fl
a1 PE=4 SV=1 MASTINTNVSSLTAQRNLSLSQSSLNTSIQRLSSGLRINSAKDDAAGLAISERFTSQIRG
LNQAVRNANDGISLAQTAEGALKSTGDILQRVRELAVQSANATNSSGDRKAIQAEVGQLL SEMDRIAGNTEFNG
QKLLDGSFGSATFQVGANANQTITATTGNFRTNNYGAQLTASAS*(178)GA ATS*(183)GASAGSAGA
AAGTVVIAGLQTKTVNVAAS*(212)GTAADIASAVNAVADSTGVTASARNVSE LKFSGTGSFTLAVKGDNS
TAANVTFNVSATSTAAGLAEAVKAFNDVSSQTGVTAKLNSDS SGLILTNESGNDINVANGASSAAGITLASQDA
ATTQSSGTLTFTTATAAGT*(351)GATVASRGT VEYKSDKGYTVSGTGGTMTTTAATSSTLTKVSDIDVST
VDGSTKALKIIDAALSAVNGQR ASFGALQSRFETTVNNLQSTSENMSASRSRIQDADFAAETANLSRSQILQQA
GTAMVAQA NQLPQGVLSLLK
Sequence Around Glycosites (21 AA)
NYGAQLTASASGAATSGASAG
LTASASGAATSGASAGSAGAA
LQTKTVNVAASGTAADIASAV
LTFTTATAAGTGATVASRGTV
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Higher molecular mass detected on SDS-PAGE, Gel code glycoside detection kit (Pierce)
Technique(s) used for Glycosylated Residue(s) Detection
HPLC analysis after digestion with trypsin and aspartic N-peptidase (sequencing), site-directed mutagenesis, MALDI-TOF MS (matrix-assisted laser desorption/ionization time of flight mass spectrometry).
Protein Glycosylation- Implication
Glycosylation regulates the induction specificity of the immune responses (such as H2O2 generation) to flagellin. It prevents recognition of the flagellin epitope (of virulent strain K1) in rice. K1 flagellin without glycans induces a strong immune response in cultured rice cells.
 
 
Glycan Information
Glycan Annotation
The sites are glycosylated by an approximately 540 Da glycan that may be a derivative of the glycan of P. syringae pv. tabaci.
Technique(s) used for Glycan Identification
Mass spectroscopy
 
 
Protein Glycosylation linked (PGL) gene(s)
Predicted Accessory Gene(s)
Fgt glycosyltransferase
 
 
Literature
Reference(s)
1) Hirai, H., Takai, R., Iwano, M., Nakai, M., Kondo, M., Takayama, S., Isogai, A. and Che, F.S. (2011) Glycosylation regulates the specific induction of rice immune responses by Acidovorax avenae flagellin. J Biol Chem. ahead of print [PMID: 21628471]
2) Che, F.S., Nakajima, Y., Tanaka, N., Iwano, M., Yoshida, T., Takayama, S., Kadota, I. and Isogai, A. (2000) Flagellin from an incompatible strain of Pseudomonas avenae induces a resistance response in cultured rice cells. J Biol Chem, 275, 32347-32356. [PubMed: 10922369]
Year of Identification
2000
Year of Validation
2011
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.