Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC103
Organism Information
Organism Name
Aneurinibacillus (Bacillus) thermoaerophilus DSM 10155
Domain
Bacteria
Classification
Family: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
sat B
 
 
Protein Information
Protein Name
Surface-layer glycoprotein Sat B
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|Q6TL21|Q6TL21_ANETH Surface-layer glycoprotein SatB OS=Aneurinibacillus ther
moaerophilus GN=satB PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANITNLVNKVLNVKSN
YDGEQSASHTLTVKE DDIAFDQTSGETFRVVLPSGVKWKTAPANTPTAKFDLRSDQVLEVTVKGTNTIADDEQVS
IPLNFKVDGATGELKLKVESMDSTITSGEYVFAIVGSGSTTAAVDNVKNIGKSGKAGTIR VEETAIGAVADGRN
HKVKLKLPSNFRWVTTGTDKTEISTSGGFTSASIVTGESNDNVLVL DVATATGQGRGVLYVTPYIKADKDASYGD
VSVNIRGPDFSDSDVVVAKYGDWGATIKVEK VEEVLAGKYDENTRTAKITIEESVPGSFVKGRDIDVELPSWVKV
TDIKEFTTSGFTTGAP TSGSVDIDGTDNKISIPLGETGGSSTAKIEFKLELSVQADKTGDIEAVISGGGVAEQKA
V IAKAVAPVSVALDGEASKVKIGAQAQDAPNIIITELKKGAIEKTTENGSTTNGTIEVKLP DGVKFASVPKVEV
VEGDGTIDVDNVRRINNDNVLTIPVKGESVSKPMKIKLSNVKLTVDR TVPEGDIELKVGGNAIVENYKSGKGWLK
GNKQNGSSDALDAGEFNTEHAAKVVVAKTVTP APTDTTATNIVFKLNSKTYTVDGKEFEMDAAPLVGWDRAYLPV
RFAANALNVSDDQIVWD DKTSTFTIFKGDRVISGKVGDKFLTVNGAKVPMDVPVWRNKEKTNNRVMVPIRYLANA
LN AEIEWNKETSEITIQAKK
Sequence length
738 AA
Subcellular Location
Surface
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein
T471 and /or S69
Experimentally Validated Glycosite(s ) in Mature Protein
T471 and /or S69
Glycosite(s) Annotated Protein Sequence
>tr|Q6TL21|Q6TL21_ANETH Surface-layer glycoprotein SatB OS=Aneurinibacillus ther
moaerophilus GN=satB PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANITNLVNKVLNVKS
NYDGEQSASHTLTVKE DDIAFDQTS*(69)GETFRVVLPSGVKWKTAPANTPTAKFDLRSDQVLEVTVKGTN
TIADDEQVS IPLNFKVDGATGELKLKVESMDSTITSGEYVFAIVGSGSTTAAVDNVKNIGKSGKAGTIR VEE
TAIGAVADGRNHKVKLKLPSNFRWVTTGTDKTEISTSGGFTSASIVTGESNDNVLVL DVATATGQGRGVLYVTP
YIKADKDASYGDVSVNIRGPDFSDSDVVVAKYGDWGATIKVEK VEEVLAGKYDENTRTAKITIEESVPGSFVKG
RDIDVELPSWVKVTDIKEFTTSGFTTGAP TSGSVDIDGTDNKISIPLGETGGSSTAKIEFKLELSVQADKTGDI
EAVISGGGVAEQKAV IAKAVAPVSVALDGEASKVKIGAQAQDAPNIIITELKKGAIEKTTENGSTT*(471)
NGTIEVKLP DGVKFASVPKVEVVEGDGTIDVDNVRRINNDNVLTIPVKGESVSKPMKIKLSNVKLTVDR TVP
EGDIELKVGGNAIVENYKSGKGWLKGNKQNGSSDALDAGEFNTEHAAKVVVAKTVTP APTDTTATNIVFKLNSK
TYTVDGKEFEMDAAPLVGWDRAYLPVRFAANALNVSDDQIVWD DKTSTFTIFKGDRVISGKVGDKFLTVNGAKV
PMDVPVWRNKEKTNNRVMVPIRYLANALN AEIEWNKETSEITIQAKK
Sequence Around Glycosites (21 AA)
IEKTTENGSTTNGTIEVKLPD
KEDDIAFDQTSGETFRVVLPS
Technique(s) used for Glycosylation Detection
Periodic acid-Schiff (PAS) staining
Technique(s) used for Glycosylated Residue(s) Detection
Modified Edman degradation
 
 
Glycan Information
Glycan Annotation
Linkage: β-GalNAc-Ser/Thr.
Total carbohydrate content of 15%.
Disaccharide repeating unit composed of L-rhamnose and D-glycero-D-manno-heptose residues: →4)-α-L-Rhap-(1→3)-β-D-glycero-D-manno-Hepp-(1→ and β-D-GalpNAc-(1→O)-Ser/Thr linkage. Equal amounts of the complete core structure α-L-Rhap-(1→3)-α-L-Rhap-(1→3)-β-D-GalpNAc-(1→O)-Ser/Thr and the truncated forms α-L-Rhap-(1→3)-β-D-GalpNAc-(1→O)-Ser/Thr and β-D-GalpNAc-(1→O)-Ser/Thr are present. The different cores were substituted with varying numbers of disaccharide repeating units.
BCSDB ID
 
 
Literature
Reference(s)
1) Messner, P., Steiner, K., Zarschler, K. and Schaffer, C. (2008) S-layer nanoglycobiology of bacteria. Carbohydr Res, 343, 1934-1951. [PubMed: 18336801]
2) Kneidinger, B., Graninger, M., Puchberger, M., Kosma, P. and Messner, P. (2001) Biosynthesis of nucleotide-activated D-glycero-D-manno-heptose. J Biol Chem, 276, 20935-20944. [PubMed: 11279237]
3) Wugeditsch, T., Zachara, N.E., Puchberger, M., Kosma, P., Gooley, A.A. and Messner, P. (1999) Structural heterogeneity in the core oligosaccharide of the S-layer glycoprotein from Aneurinibacillus thermoaerophilus DSM 10155. Glycobiology, 9, 787-795.[PubMed: 10406844]
4) Kosma, P., Wugeditsch, T., Christian, R., Zayni, S. and Messner, P. (1995) Glycan structure of a heptose-containing S-layer glycoprotein of Bacillus thermoaerophilus. Glycobiology, 5, 791-796. [PubMed: 8720077]
Year of Identification
1995
Year of Validation
1999
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.