Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC104
Organism Information
Organism Name
Aneurinibacillus (Bacillus) thermoaerophilus L420-91T (DSM 10154) and GS4-97
Domain
Bacteria
Classification
Family: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
sat A
 
 
Protein Information
Protein Name
Surface-layer glycoprotein SatA
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|Q6TL22|Q6TL22_ANETH Surface-layer glycoprotein SatA OS=Aneurinibacillus ther
moaerophilus GN=satA PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANSTNLVDKRVQVGSN
SEINGTSHLIVKEDD KKFRVSTGDTFRVELPAGTEWKFSDSEFYVDGSGNVYSSESSASPDTKAKVNVISSRTIE
VRPLGNGFKSGDPDSKNAINIPLHVKVNGASGELKLKIDSMNSTVTSGEYVFATVNTGNT RAVVDTVRYIGKNG
IGGQIRIDENFAGAISAGTHSLKLKLPSNFEWDDMSSGEIKFGGSF FGNAKVDGAIIGNGDNTLTIPVKISQSTS
GATPGYIYITPKIKAKSDAAKGTDVTVNISG GDFSDADLTVAKYGDYDANIKVEKVEELVAGKFDEYTKTAKITI
EESVPGSFYKDRDIDV KFPSWVKVVEVSDWSTSGVKANKPKNIDGTDDEFSIKIEEPTTKENTTPGRIEFKVRLS
I DANKTGDIEATVSGGGIKEQKAVVAKAIAPAAVSVEGDTSKLKIGAQDQEGPTFYITEAK KGVFEKNVEGPSG
NGEIIVRLASGVKFSKVPKVEVVEGDGPIDTSNVRRIENDNALAIPI KGESTSKPMKLKVSDVRLTLDRTVPEGD
IEAKIGGSAVVENYVKDSKGWVGTGLYTGTDN KNPGTFNTQHAVTFKIGSTITPAPSDTTAKNIVFKLNSKTYTV
DGKEIEMDAAPLVGWDR AYLPVRFAANALNVSDDQIIWDDKTSTFTIFKGDRVISGKVGDKFLTINGVKTPMDVP
VW RNKEKTNNRVMVPIRYLANALNAEINWNKETSEITIQVK
Sequence length
759 AA
Subcellular Location
Surface
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein
T67
Experimentally Validated Glycosite(s ) in Mature Protein
T67
Glycosite(s) Annotated Protein Sequence
>tr|Q6TL22|Q6TL22_ANETH Surface-layer glycoprotein SatA OS=Aneurinibacillus ther
moaerophilus GN=satA PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANSTNLVDKRVQVGS
NSEINGTSHLIVKEDD KKFRVST*(67)GDTFRVELPAGTEWKFSDSEFYVDGSGNVYSSESSASPDTKAKV
NVISSRTIE VRPLGNGFKSGDPDSKNAINIPLHVKVNGASGELKLKIDSMNSTVTSGEYVFATVNTGNT RAV
VDTVRYIGKNGIGGQIRIDENFAGAISAGTHSLKLKLPSNFEWDDMSSGEIKFGGSF FGNAKVDGAIIGNGDNT
LTIPVKISQSTSGATPGYIYITPKIKAKSDAAKGTDVTVNISG GDFSDADLTVAKYGDYDANIKVEKVEELVAG
KFDEYTKTAKITIEESVPGSFYKDRDIDV KFPSWVKVVEVSDWSTSGVKANKPKNIDGTDDEFSIKIEEPTTKE
NTTPGRIEFKVRLSI DANKTGDIEATVSGGGIKEQKAVVAKAIAPAAVSVEGDTSKLKIGAQDQEGPTFYITEA
K KGVFEKNVEGPSGNGEIIVRLASGVKFSKVPKVEVVEGDGPIDTSNVRRIENDNALAIPI KGESTSKPMKL
KVSDVRLTLDRTVPEGDIEAKIGGSAVVENYVKDSKGWVGTGLYTGTDN KNPGTFNTQHAVTFKIGSTITPAPS
DTTAKNIVFKLNSKTYTVDGKEIEMDAAPLVGWDR AYLPVRFAANALNVSDDQIIWDDKTSTFTIFKGDRVISG
KVGDKFLTINGVKTPMDVPVW RNKEKTNNRVMVPIRYLANALNAEINWNKETSEITIQVK
Sequence Around Glycosites (21 AA)
KEDDKKFRVSTGDTFRVELPA
Technique(s) used for Glycosylation Detection
Periodic acid-Schiff (PAS)-staining
Technique(s) used for Glycosylated Residue(s) Detection
N-terminal sequencing and C-13 NMR
 
 
Glycan Information
Glycan Annotation
Linkage: β-GalNAc-Ser/Thr.
Hexasaccharide repeating unit (an average of 15 repeats) with the constituents D-rhamnose and 3-N-acetyl-D-fucosamine (3-acetamido-3,6-dideoxy-D-galactose); and β-D-GalNAc-Ser/Thr linkage. An O-methyl group on the non-reducing terminal rhamnose.
BCSDB ID
 
 
Literature
Reference(s)
1) Messner, P., Steiner, K., Zarschler, K. and Schaffer, C. (2008) S-layer nanoglycobiology of bacteria. Carbohydr Res, 343, 1934-1951. [PubMed: 18336801]
2) Pfoestl, A., Hofinger, A., Kosma, P. and Messner, P. (2003) Biosynthesis of dTDP-3-acetamido-3,6-dideoxy-alpha-D-galactose in Aneurinibacillus thermoaerophilus L420-91T. J Biol Chem, 278, 26410-26417. [PubMed: 12740380]
3) Schaffer, C., Muller, N., Christian, R., Graninger, M., Wugeditsch, T., Scheberl, A. and Messner, P. (1999) Complete glycan structure of the S-layer glycoprotein of Aneurinibacillus thermoaerophilus GS4-97. Glycobiology, 9, 407-414. [PubMed: 10089215]
4) Kosma, P., Neuninger, C., Christian, R., Schulz, G. and Messner, P. (1995) Glycan structure of the S-layer glycoprotein of Bacillus sp. L420-91. Glycoconj J, 12, 99-107.[PubMed: 7795419]
Year of Identification
1995
Year of Validation
1999
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.