Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC107
Organism Information
Organism Name
Bacteroides fragilis (strain ATCC 25285 / NCTC 9343)
Domain
Bacteria
Classification
Family: Bacteroidaceae
Order: "Bacteroidales"
Class: "Bacteroidia"
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
The Bacteroides constitute the major population of human intestinal microbiota. They are beneficial to the humans in terms of metabolism, development, and immunity. They play roles in recycling of bile acids, provision of short-chain fatty acids to the host and angiogenesis.
 
 
Gene Information
Gene Name
BF0810 
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
BF0810
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
449 AA
Function
Putative alpha-L-fucosidase.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein
T84, T281 (Engineered glycosylation site DTA was created at two positions F83D and N282A)
Experimentally Validated Glycosite(s ) in Mature Protein
T84, T281 (Engineered glycosylation site DTA was created at two positions F83D and N282A)
Glycosite(s) Annotated Protein Sequence
>tr|Q5LH32|Q5LH32_BACFN Putative alpha-L-fucosidase OS=Bacteroides fragilis (str
ain ATCC 25285 / NCTC 9343) GN=BF0810 PE=4 SV=1
MKNNRLIITLIALFLLGFGLKA
QTASTEETAAQKEKRMEWFAQAKLGIFIHWGIYAVNGV SESWSFFNNYLPYEEYMAQEKGDT*(84)ASAYN
PQEWVKLIKESGARYTVITTKHHDGVALWDT KAGDLSTVKSTPAGRDLIAPFVKEVRKQGLKLGFYYSLLDWSH
PDYPNKTRTEVRYKNDP DRWAKFVKFNFGQLSELNKTWKPDLYWFDGDWEQTAEAWDSKGIINLLRSTNPNVIV
NSR IQGYGDYATPEQGVPVVRPADKYWELCMTMNDSWGYQHADT*(281)AYKTPFMLLRTFVDCLSMG G
NLLLDIGPKEDGTIPAEQIAVLKEFGRWTKKHKEAIYETRAGIPCEHFQGYTTLNKAGD ILYLYLPYKPNGPIE
VKGLVNKVNRVWVVGNGAMLPYKVYNKNYWSEVPGNLYIDIPERV QDEQITVIAVLLDGPIKLYRGVGQVIESN
Sequence Around Glycosites (21 AA)
EEYMAQEKGFTASAYNPQEWV
NDSWGYQHADTNYKTPFMLLR
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Coomassie staining, Pro-Q Emerald glycostaining, and reactivity with anti-glycan serum
Technique(s) used for Glycosylated Residue(s) Detection
Known residues are mutated to create glycosylation motif/sequon
 
 
Glycan Information
Glycan Annotation
Exogenous fucose.
Technique(s) used for Glycan Identification
Lectin (AAL)binding
 
 
Literature
Reference(s)
1) Fletcher, C.M., Coyne, M.J. and Comstock, L.E. (2011) Theoretical and experimental characterization of the scope of protein O-glycosylation in Bacteroides fragilis. J Biol Chem, 286, 3219-3226. [PubMed: 21115495]
Additional Comments
Engineered glycoprotein.
An example of engineered glycoprotein from a native protein.
Glycosylation sequon features: the sequon has an aspartate (D) preceding the glycosylated T or S which is followed by an amino acid with one or more methyl groups (alanine, isoleucine, or leucine; (D)(S/T)(A/I/L/V/M/T). Moreover, none of the 17 unglycosylated S and T residues examined in BF2494 (excluding two in the signal peptide) have a preceding D, although seven are followed by A, I, or L and one by V. Non methylated amino acids are not tolerated at third position of sequon in BF2494. Ile, Leu, and Val are found most frequently whereas Met is rarest at third position (reflecting the otherwise low number of Mets in proteins compared with the other five amino acids at the third position of the motif). The methyl group-containing amino acid at the third position being unreactive may play a role only in recognition of the site, whereas Asp residue may play a catalytic role.
Year of Identification
2011
Year of Validation
2011
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.