Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC116
Organism Information
Organism Name
Campylobacter jejuni serotype O:23/36 (strain 81-176)
Domain
Bacteria
Classification
Family: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity.
 
 
Gene Information
Gene Name
Cjp3 (CJJ81176_pVir0003)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
VirB10 protein
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
378 AA
Subcellular Location
Periplasmic or on surface
Function
Type IV secretion (TFSS) homolog. The TFSS genes present on pVir have been proposed to encode proteins that form a functional secretion channel that appears to affect both intestinal epithelial cell invasion and natural competence.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
N32, N97
Experimentally Validated Glycosite(s ) in Mature Protein
N32, N97
Glycosite(s) Annotated Protein Sequence
>tr|Q9KIS0|Q9KIS0_CAMJJ VirB10 OS=Campylobacter jejuni subsp. jejuni serotype O:
23/36 (strain 81-176) GN=virB10 PE=4 SV=1 MKKSFLSLSLATILLSNNLFAEDIFDQTSEEN
*(32)
VSKNISKKDNQSQNLLNKEDLDYLFKNS DTKFPVTDYIYKGGFKEPNEDIKIHSEEKPKKEEDNN*(
97)
ITKLAKIEEKKQELIQKNQQIAK EIHQDNISSQERKIKKLIRDSILADRGNTQIYFQENSSKYGVDGFSN
QKSIDVSTNEHRL YRMIRAGRLIPALLTSAISSDLQGIVTAQIEQDIYASMGNAVLIPRGSKAIGFYKNDNKI
GQNRLEIQWREIITPQGVNILLTNALASDNMGMAGAVGSVNNKYLERYGMPYALSTISNV LLLSIASKAGNNN
YAQEVYSQSKNDVSTIVDDIIQQQSQIKPTIEIKSGSRIFIVPTNHM WFAKPKNNEVLIQYFQDN
Sequence Around Glycosites (21 AA)
EDIFDQTSEENVSKNISKKDN
EEKPKKEEDNNITKLAKIEEK
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Mass shift detected on SDS-polyacrylamide gel and SBA (soybean agglutinin) lectin-agarose affinity chromatography
Technique(s) used for Glycosylated Residue(s) Detection
Site-directed mutagenesis
Protein Glycosylation- Implication
Glycosylation of VirB10 at N97, but not at N32, is essential for wild-type (full) levels of competence. VirB10 is not detected in the pgl mutants. It reflects instability of the nonglycosylated protein, perhaps a result of an inability to interact with other TFSS proteins.
 
 
Glycan Information
Glycan Annotation
Terminal α1,3-linked GalNAc.
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
pglB
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
PglB
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
>tr|A1W0B2|A1W0B2_CAMJJ General glycosylation pathway protein OS=Campylobacter j
ejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pglB PE=4 SV=1 MLKKE
YLKNPYLVLFAMIVLAYVFSVLCRFYWIWWASEFNEYFFNNQLMIISNDGYAFAE GARDMIAGFHQPNDLSYYGS
SLSTLTYWLYKITPFSFESIILYMSTFLSSLVVIPIILLA NEYKRPLMGFVAALLASIANSYYNRTMSGYYDTDM
LVIVLPMFILFFMVRMILKKDFFSL IALPLFIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIFYIAVILSS
LTLSNIAWFY QSTIIVILFALFALEQKRLNFVIIGILASVTLIFLILSGGVDPILYQLKFYIFRSDESAN LTQG
FMYFNVNQTIQEVENVDLSEFMRRISGSEIVFLFSLFGFVWLLRKHKSMIMALPIL VLGFLALKGGLRFTIYSVP
VMALGFGFLLSEFKAILVKKYSQLTSNVCIVFATILTLAPV FIHIYNYKAPTVFSQNEASLLNQLKNIANREDYV
VTWWDYGYPVRYYSDVKTLVDGGKHL GKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAM
MKDYNQSNVDL FLASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPL DVK
NGEIYLSNGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFY LKDSAIPYAQFILMDKTM
FNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI
OST PDB ID
3AAG
OST EC Number (BRENDA)
OST Genome Context
Predicted Accessory Gene(s)
Putative glycosyltransferases involved are PglA, PglC, PglD, PglE, PglF, PglG.
 
 
Literature
Reference(s)
1) Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J. and Kohda, D. (2010) Comparative structural biology of eubacterial and archaeal oligosaccharyltransferases. J Biol Chem, 285, 4941-4950. [PubMed: 20007322]
2) Larsen, J.C., Szymanski, C. and Guerry, P. (2004) N-linked protein glycosylation is required for full competence in Campylobacter jejuni 81-176. J Bacteriol, 186, 6508-6514. [PubMed: 15375132]
Additional Comments
Sequon feature: The consensus sequence for the C jejuni PglB is D/E-X'-N-X"-S/T (where X' and X" stand for any amino acid except proline).
Year of Identification
2004
Year of Validation
2004
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.