Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC117
Organism Information
Organism Name
Campylobacter jejuni NCTC 11168
Domain
Bacteria
Classification
Family: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity.
 
 
Protein Information
Protein Name
Synthetic Glycopeptide
UniProtKB/SwissProt ID
UniProtKB Sequence
KDFNVSKA
Sequence length
5 AA
Subcellular Location
NA
Function
NA
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
N4
Experimentally Validated Glycosite(s ) in Mature Protein
N4
Glycosite(s) Annotated Protein Sequence
KDFN*(4)VSKA
Technique(s) used for Glycosylation Detection
In vitro chemo enzymatic glycosylation,HPLC analysis of glycopeptides with reference to known glycopeptide HPLC profiles
Technique(s) used for Glycosylated Residue(s) Detection
Not applicable
Protein Glycosylation- Implication
Not applicable
 
 
Glycan Information
Glycan Annotation
GalNAc-α1,3-bacillosamine.
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
pglB
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
PglB
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
>tr|A1W0B2|A1W0B2_CAMJJ General glycosylation pathway protein OS=Campylobacter j
ejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pglB PE=4 SV=1 MLKKE
YLKNPYLVLFAMIVLAYVFSVLCRFYWIWWASEFNEYFFNNQLMIISNDGYAFAE GARDMIAGFHQPNDLSYYGS
SLSTLTYWLYKITPFSFESIILYMSTFLSSLVVIPIILLA NEYKRPLMGFVAALLASIANSYYNRTMSGYYDTDM
LVIVLPMFILFFMVRMILKKDFFSL IALPLFIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIFYIAVILSS
LTLSNIAWFY QSTIIVILFALFALEQKRLNFVIIGILASVTLIFLILSGGVDPILYQLKFYIFRSDESAN LTQG
FMYFNVNQTIQEVENVDLSEFMRRISGSEIVFLFSLFGFVWLLRKHKSMIMALPIL VLGFLALKGGLRFTIYSVP
VMALGFGFLLSEFKAILVKKYSQLTSNVCIVFATILTLAPV FIHIYNYKAPTVFSQNEASLLNQLKNIANREDYV
VTWWDYGYPVRYYSDVKTLVDGGKHL GKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAM
MKDYNQSNVDL FLASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPL DVK
NGEIYLSNGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFY LKDSAIPYAQFILMDKTM
FNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI
OST PDB ID
3AAG
OST EC Number (BRENDA)
OST Genome Context
 
 
Literature
Reference(s)
1) Glover, K.J., Weerapana, E., Numao, S. and Imperiali, B. (2005) Chemoenzymatic synthesis of glycopeptides with PglB, a bacterial oligosaccharyl transferase from Campylobacter jejuni. Chem Biol, 12, 1311-1315. [PubMed: 16356848]
Additional Comments
Engineered glycopeptide.
In vitro characterization of the oligosaccharyl transferase activity of PglB protein from membrane fraction of Campylobacter jejuni using a synthetic disaccharide glycan donor (GalNAc-α1,3-bacillosamine-pyrophosphate-undecaprenyl) and a peptide acceptor substrate (KDFNVSKA).
Year of Identification
2005
Year of Validation
2005
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.