Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC124
Organism Information
Organism Name
Campylobacter jejuni NCTC 11168 serotype O:2
Domain
Bacteria
Classification
Family: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity.
 
 
Gene Information
Gene Name
Cj0734c (hisJ)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
HisJ
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
256 AA
Subcellular Location
Periplasm
Function
A component of the histidine uptake system.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
N29
Experimentally Validated Glycosite(s ) in Mature Protein
N29
Glycosite(s) Annotated Protein Sequence
>sp|Q46125|HISJ_CAMJE Histidine-binding protein OS=Campylobacter jejuni GN=hisJ
PE=1 SV=1 MKKFLTAFLVAFTGLFLGACSDSKNKESN*(29)ASVELKVGTAPNYKPFNFKQDSKLTG F
DTDLIEEIAKKNGIEIVWVETNFDGLIPALKSGKIDMIASAMSATDERRQSVDFTKPYY MSKNLYLKLKNNDSL
QTKNDLEGKKIGVQLGTLQENTAKAIKNAQVQSNKDLNIAVLALK NNKIDAIVADQDTAKGFLAENPELVSFYQ
ETDGGEGFSFAFDKNKQKDIIEIFNKGIDEA KTDGFYDTLIKKYELE
Sequence Around Glycosites (21 AA)
ACSDSKNKESNASVELKVGTA
Technique(s) used for Glycosylation Detection
Immunoblot analysis using glycosylation-specific R12 antiserum, SBA (soybean agglutinin) lectin-agarose affinity chromatography, Slow/ aberrant migration on SDS-PAGE
Technique(s) used for Glycosylated Residue(s) Detection
Site-directed mutagenesis (N28L)
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
pglB (Cj1126c)
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
PglB
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
>tr|Q0P9C8|Q0P9C8_CAMJE Oligosaccharide transferase to N-glycosylate proteins OS
=Campylobacter jejuni GN=pglB PE=4 SV=1 MLKKEYLKNPYLVLFAMIVLAYVFSVFCRFYWVWWA
SEFNEYFFNNQLMIISNDGYAFAE GARDMIAGFHQPNDLSYYGSSLSTLTYWLYKITPFSFESIILYMSTFLSSL
VVIPIILLA NEYKRPLMGFVAALLASVANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSL IALPL
FIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFY QSAIIVILFALFALEQKRLN
FMIIGILGSATLIFLILSGGVDPILYQLKFYIFRSDESAN LTQGFMYFNVNQTIQEVENVDFSEFMRRISGSEIV
FLFSLFGFVWLLRKHKSMIMALPIL VLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAILVKKYSQLTSNVCIV
FATILTLAPV FIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVKTLVDGGKHL GKDN
FFPSFSLSKDEQAAANMARLSVEYTEKSFYAPQNDILKSDILQAMMKDYNQSNVDL FLASLSKPDFKIDTPKTRD
IYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPL DVKNGEIYLSNGVVLSDDFRSFKIGDNVVSVNSI
VEINSIKQGEYKITPIDDKAQFYIFY LKDSAIPYAQFILMDKTMFNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI
OST PDB ID
3AAG
OST EC Number (BRENDA)
OST Genome Context
PGL Additional Links
 
 
Literature
Reference(s)
1) Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J. and Kohda, D. (2010) Comparative structural biology of eubacterial and archaeal oligosaccharyltransferases. J Biol Chem, 285, 4941-4950. [PubMed: 20007322]
2) Nita-Lazar, M., Wacker, M., Schegg, B., Amber, S. and Aebi, M. (2005) The N-X-S/T consensus sequence is required but not sufficient for bacterial N-linked protein glycosylation. Glycobiology, 15, 361-367. [PubMed: 15574802]
Additional Comments
Glycosylation at sequon 28-N-A-S-30 and not at the other potential sequon 132-N-D-S-134 in glycosylation competent recombinant E.coli strain as well as in native host strain suggests for the first time that N-X-S/T sequon is required but not sufficient in case of campylobacter/ bacterial N glycosylation. Seat of glycosylation was found to be periplasm. N127 is experimentally proved (by site directed mutagenesis) as non-glycosylated sequon.
Sequence conflict has been observed at many places. Regarding the glycosite, it is from 18V to 38T → GACSDSKNKESNASVE (21 residues).
Year of Identification
2005
Year of Validation
2005
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.