Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC125
Organism Information
Organism Name
Campylobacter jejuni NCTC 11168 serotype O:2
Domain
Bacteria
Classification
Family: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity.
 
 
Gene Information
Gene Name
Cj0289c
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
PEB3
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
250 AA
Subcellular Location
Surface
Function
Functions as an adhesin ; also a transport protein that may function in utilization of 3-phosphoglycerate or other phosphate-containing molecules from the host.
 
 
Protein Structure
PDB ID
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
N90
Experimentally Validated Glycosite(s ) in Mature Protein
N90
Glycosite(s) Annotated Protein Sequence
>tr|Q0PBL7|Q0PBL7_CAMJE Major antigenic peptide PEB3 OS=Campylobacter jejuni GN=
peb3 PE=1 SV=1 MKKIITLFGACALAFSMANADVNLYGPGGPHTALKDIANKYSEKTGVKVNVNFGPQATWF
EKAKKDADILFGASDQSALAIASDFGKDFN*(90)VSKIKPLYFREAIILTQKGNPLKIKGLKDL ANKKV
RIVVPEGAGKSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSARKLFAQ DQADAWITWIDWSKSNPDI
GTAVAIEKDLVVYRTFNVIAKEGASKETQDFIAYLSSKEAK EIFKKYGWRE
Sequence Around Glycosites (21 AA)
AIASDFGKDFNVSKIKPLYFR
Technique(s) used for Glycosylation Detection
SBA (soybean agglutinin) lectin-agarose affinity chromatography
Technique(s) used for Glycosylated Residue(s) Detection
CapLC-MS/MS (capillary liquid chromatography-tandem mass spectrometry)
 
 
Glycan Information
Glycan Annotation
Linkage: Bac-Asn.
1406 Da heptasaccharide composed of GalNAc-α1,4-GalNAc-α1,4-[Glcβ1,3-]GalNAc-α1,4-GalNAc-α1,4-GalNAc-α1,3-Bac-β1,N-Asn-Xaa, where Bac is bacillosamine, 2,4-diacetamido-2,4,6-trideoxyglucopyranose.
BCSDB ID
Technique(s) used for Glycan Identification
1H, 13C NMR spectroscopy- one dimensional TOCSY (total correlation spectroscopy) and NOESY (nuclear Overhauser effect spectroscopy); HMBC (heteronuclear multiple bond coherence), HMQC (heteronuclear multiple quantum correlation) spectra.
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
pglB (Cj1126c)
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
PglB
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
>tr|Q0P9C8|Q0P9C8_CAMJE Oligosaccharide transferase to N-glycosylate proteins OS
=Campylobacter jejuni GN=pglB PE=4 SV=1 MLKKEYLKNPYLVLFAMIVLAYVFSVFCRFYWVWWA
SEFNEYFFNNQLMIISNDGYAFAE GARDMIAGFHQPNDLSYYGSSLSTLTYWLYKITPFSFESIILYMSTFLSSL
VVIPIILLA NEYKRPLMGFVAALLASVANSYYNRTMSGYYDTDMLVIVLPMFILFFMVRMILKKDFFSL IALPL
FIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIFYIAVILSSLTLSNIAWFY QSAIIVILFALFALEQKRLN
FMIIGILGSATLIFLILSGGVDPILYQLKFYIFRSDESAN LTQGFMYFNVNQTIQEVENVDFSEFMRRISGSEIV
FLFSLFGFVWLLRKHKSMIMALPIL VLGFLALKGGLRFTIYSVPVMALGFGFLLSEFKAILVKKYSQLTSNVCIV
FATILTLAPV FIHIYNYKAPTVFSQNEASLLNQLKNIANREDYVVTWWDYGYPVRYYSDVKTLVDGGKHL GKDN
FFPSFSLSKDEQAAANMARLSVEYTEKSFYAPQNDILKSDILQAMMKDYNQSNVDL FLASLSKPDFKIDTPKTRD
IYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPL DVKNGEIYLSNGVVLSDDFRSFKIGDNVVSVNSI
VEINSIKQGEYKITPIDDKAQFYIFY LKDSAIPYAQFILMDKTMFNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI
OST PDB ID
3AAG
OST EC Number (BRENDA)
OST Genome Context
Characterized Accessory Gene(s)
PglA, PglJ, PglH, PglI, PglC are glycosyltransferases involved in the heptasaccharide assembly. PglFED are the bacillosamine biosynthetic enzymes. PglK is a flippase.
PGL Additional Links
 
 
Literature
Reference(s)
1) Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J. and Kohda, D. (2010) Comparative structural biology of eubacterial and archaeal oligosaccharyltransferases. J Biol Chem, 285, 4941-4950. [PubMed: 20007322]
2) Rangarajan, E.S., Bhatia, S., Watson, D.C., Munger, C., Cygler, M., Matte, A. and Young, N.M. (2007) Structural context for protein N-glycosylation in bacteria: The structure of PEB3, an adhesin from Campylobacter jejuni. Protein Sci, 16, 990-995. [PubMed: 17456748]
3) Olivier, N.B., Chen, M.M., Behr, J.R. and Imperiali, B. (2006) In vitro biosynthesis of UDP-N,N'-diacetylbacillosamine by enzymes of the Campylobacter jejuni general protein glycosylation system. Biochemistry, 45, 13659-13669. [PubMed: 17087520]
4) Linton, D., Allan, E., Karlyshev, A.V., Cronshaw, A.D. and Wren, B.W. (2002) Identification of N-acetylgalactosamine-containing glycoproteins PEB3 and CgpA in Campylobacter jejuni. Mol Microbiol, 43, 497-508. [PubMed: 11985725]
5) Young, N.M., Brisson, J.R., Kelly, J., Watson, D.C., Tessier, L., Lanthier, P.H., Jarrell, H.C., Cadotte, N., St Michael, F., Aberg, E. et al. (2002) Structure of the N-linked glycan present on multiple glycoproteins in the Gram-negative bacterium, Campylobacter jejuni. J Biol Chem, 277, 42530-42539. [PubMed: 12186869]
Additional Comments
Sequon feature: The consensus sequence for the C jejuni PglB is D/E-X'-N-X"-S/T (where X' and X" stand for any amino acid except proline) which is glycosylated when located in flexible, exposed structural elements. Tripeptide sequence NLT too has been found to be modified in vitro.
Year of Identification
2002
Year of Validation
2002
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.