Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC127
Organism Information
Organism Name
Campylobacter jejuni serotype O:23/36 (strain 81-176) /JHH1
Domain
Bacteria
Classification
Family: Campylobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Campylobacter jejuni is a microaerophilic, Gram-negative, human pathogen that is the major cause of bacterial food-borne diarrhoea (gastroenteritis). It is most frequently responsible for a form of post-infection neuromuscular paralysis known as Guillain Barre' syndrome. It also leads to an immunoproliferative small intestine disease that is a rare malignant lymphoma of the intestine. Motility is essential for pathogenicity.
 
 
Gene Information
Gene Name
JlpA (CJJ81176_1002)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
JlpA (42-45 kDa antigen)
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
372 AA
Subcellular Location
Surface
Function
Surface-associated lipoprotein that is antigenic. Promotes adherence to epithelial cells, potentially via interactions with surface-exposed hsp 90-α. Role in colonization of chicken.
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
N146, N107 or N146 only
Experimentally Validated Glycosite(s ) in Mature Protein
N146, N107 or N146 only
Glycosite(s) Annotated Protein Sequence
>tr|A1VZX2|A1VZX2_CAMJJ Surface-exposed lipoprotein OS=Campylobacter jejuni subs
p. jejuni serotype O:23/36 (strain 81-176) GN=jlpA PE=4 SV=1 MKKGIFLSIGIAVL
FSACGNSIDEKTVKKYENQLNQTVKQEIASLSQDSGIKIEFSDFKC NADGDFIACLSPNFKTLAKDNNDEYQEL
FQAKNIKIRSNEIYKGETN*(107)TSISIKEYYNDLF KNQKSIQSNLVFEDFKLGEKVVSDIN*(146)
ASLFQQDPKISSFINKLSSDSYTLSFDNSINKQE NNYLDNLDIKFYNAKLNFNTNLNINLKEDLLNYLDSKGIK
FNTQTLAMDEQAINELLNMV NYEQASDFSNTIQKYIILNNFKIDSTLKTEGVFSSYIATAKENLQTLKAQSQNE
EQALIF DKALAILNNITQNDDYKLNLDLKFKNIPVSDYSTQGIDSIEKLSINNQDATEALKIILPF IMFSML
MGGASF
Sequence Around Glycosites (21 AA)
RSNEIYKGETNTSISIKEYYN
KLGEKVVSDINASLFQQDPKI
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
SBA (soybean agglutinin) affinity chromatography and detection of multiple bands on Western blot
Technique(s) used for Glycosylated Residue(s) Detection
ESI/MS-MS (electrospray-ionization-tandem mass spectrometry)
Protein Glycosylation- Implication
Glycosylation is not required for antigenicity.
 
 
Glycan Information
Glycan Annotation
Linkage: Bac-Asn.
1406 Da heptasaccharide composed of HexNAc-HexNAc-[Hex-]HexNAc-HexNAc-HexNAc-Bac-N-Asn-Xaa, where Bac is bacillosamine, 2,4-diacetamido-2,4,6-trideoxyglucopyranose.
Technique(s) used for Glycan Identification
1H, 13C NMR spectroscopy- one dimensional TOCSY (total correlation spectroscopy) and NOESY (nuclear Overhauser effect spectroscopy); HMBC (heteronuclear multiple bond coherence), HMQC (heteronuclear multiple quantum correlation) spectra.
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
pglB
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
PglB
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
>tr|A1W0B2|A1W0B2_CAMJJ General glycosylation pathway protein OS=Campylobacter j
ejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pglB PE=4 SV=1 MLKKE
YLKNPYLVLFAMIVLAYVFSVLCRFYWIWWASEFNEYFFNNQLMIISNDGYAFAE GARDMIAGFHQPNDLSYYGS
SLSTLTYWLYKITPFSFESIILYMSTFLSSLVVIPIILLA NEYKRPLMGFVAALLASIANSYYNRTMSGYYDTDM
LVIVLPMFILFFMVRMILKKDFFSL IALPLFIGIYLWWYPSSYTLNVALIGLFLIYTLIFHRKEKIFYIAVILSS
LTLSNIAWFY QSTIIVILFALFALEQKRLNFVIIGILASVTLIFLILSGGVDPILYQLKFYIFRSDESAN LTQG
FMYFNVNQTIQEVENVDLSEFMRRISGSEIVFLFSLFGFVWLLRKHKSMIMALPIL VLGFLALKGGLRFTIYSVP
VMALGFGFLLSEFKAILVKKYSQLTSNVCIVFATILTLAPV FIHIYNYKAPTVFSQNEASLLNQLKNIANREDYV
VTWWDYGYPVRYYSDVKTLVDGGKHL GKDNFFPSFALSKDEQAAANMARLSVEYTEKSFYAPQNDILKTDILQAM
MKDYNQSNVDL FLASLSKPDFKIDTPKTRDIYLYMPARMSLIFSTVASFSFINLDTGVLDKPFTFSTAYPL DVK
NGEIYLSNGVVLSDDFRSFKIGDNVVSVNSIVEINSIKQGEYKITPIDDKAQFYIFY LKDSAIPYAQFILMDKTM
FNSAYVQMFFLGNYDKNLFDLVINSRDAKVFKLKI
OST PDB ID
3AAG
OST EC Number (BRENDA)
OST Genome Context
Predicted Accessory Gene(s)
Putative glycosyltransferases involved are PglA, PglC, PglD, PglE, PglF, PglG.
PGL Additional Information
Campylobacter jejuni 81-176 pgl mutants impaired in general protein glycosylation showed reduced ability to adhere to and invade INT407 cells and to colonize intestinal tracts of mice.
 
 
Literature
Reference(s)
1) Maita, N., Nyirenda, J., Igura, M., Kamishikiryo, J. and Kohda, D. (2010) Comparative structural biology of eubacterial and archaeal oligosaccharyltransferases. J Biol Chem, 285, 4941-4950. [PubMed: 20007322]
2) Scott, N.E., Bogema, D.R., Connolly, A.M., Falconer, L., Djordjevic, S.P. and Cordwell, S.J. (2009) Mass spectrometric characterization of the surface-associated 42 kDa lipoprotein JlpA as a glycosylated antigen in strains of Campylobacter jejuni. J Proteome Res, 8, 4654-4664. [PubMed: 19689120]
3) Szymanski, C.M., Burr, D.H. and Guerry, P. (2002) Campylobacter protein glycosylation affects host cell interactions. Infect Immun, 70, 2242-2244. [Pubmed: 11895996]
Additional Comments
Sequon feature: The consensus sequence for the C jejuni PglB is D/E-X'-N-X"-S/T (where X' and X" stand for any amino acid except proline) which is glycosylated when located in flexible, exposed structural elements. Tripeptide sequence NLT too has been found to be modified in vitro.
Year of Identification
2009
Year of Validation
2009
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.