Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC129
Organism Information
Organism Name
Clostridium botulinum F str. Langeland/ A str. FE9909ACS Alberta
Domain
Bacteria
Classification
Family: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Clostridium botulinum is a Gram-positive spore-forming anaerobic bacterium that causes botulism. Botulism is a descending symmetrical paralysis caused by botulinum neurotoxin (BoNT). Regarding the way of its entrance into the body, it can lead to infant/adult intestinal toxaemia, wound botulism, or food-borne botulism.
 
 
Gene Information
Gene Name
flaA (CLI_2781)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Flagellin (FlaA)
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
273 AA
Subcellular Location
Surface
Function
Forms the filaments of bacterial flagella.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
S126, S139, S142, S165, S171, S176, S182
Experimentally Validated Glycosite(s ) in Mature Protein
S126, S139, S142, S165, S171, S176, S182
Glycosite(s) Annotated Protein Sequence
>tr|A7GGU9|A7GGU9_CLOBL Flagellin OS=Clostridium botulinum (strain Langeland / N
CTC 10281 / Type F) GN=CLI_2781 PE=4 SV=1 MIINHNLNAMNAHRQMAINTGSNGKAIEKLSSG
LRINRAGDDAAGLAISEKMRGQIRGLN QASRNSQDSISLIQTAEGALNETHSILQRMRELAVQSANDTNVKVDR
DNLQKEVAELQNE INRIAS*(126)QTQFNTKNLLNGS*(139)AKS*(142)MVFQIGANKDQVMEL
TIAGMGTS*(165)ALKVGS*(171)INIGS*(176)GKGA KS*(182)ISGMIETIDNAINTVSG
ERAKLGANQNRLEHTIANLDNSAENLQAAESRIRDVDMAKE MMNFTKTNILTQAAQAMLAQANQAPQGVLQLLR
Sequence Around Glycosites (21 AA)
ELQNEINRIASQTQFNTKNLL
QFNTKNLLNGSAKSMVFQIGA
TKNLLNGSAKSMVFQIGANKD
MELTIAGMGTSALKVGSINIG
GMGTSALKVGSINIGSGKGAK
ALKVGSINIGSGKGAKSISGM
INIGSGKGAKSISGMIETIDN
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Mass spectrometry
Technique(s) used for Glycosylated Residue(s) Detection
Electron transfer dissociation (ETD) MS with and without collision-activated dissociation (CAD).
 
 
Glycan Information
Glycan Annotation
A novel legionaminic acid derivative (417 Da), 7-acetamido-5-(N-methyl-glutam-4-yl)-amino-3,5,7,9-tetradeoxy-D-glycero-α-D-galacto-nonulosonic acid, (αLeg5GluNMe7Ac).
BCSDB ID
Technique(s) used for Glycan Identification
Homonuclear and heteronuclear 1H, 13C-NMR spectra, selective TOCSY (total correlation spectroscopy), HSQC (heteronuclear single quantum coherence), HMBC (heteronuclear multiple bond coherence).
 
 
Protein Glycosylation linked (PGL) gene(s)
Characterized Accessory Gene(s)
Information currently not available with us.
PGL Additional Links
 
 
Literature
Reference(s)
1) Twine, S.M., Paul, C.J., Vinogradov, E., McNally, D.J., Brisson, J.R., Mullen, J.A., McMullin, D.R., Jarrell, H.C., Austin, J.W., Kelly, J.F. et al. (2008) Flagellar glycosylation in Clostridium botulinum. FEBS J, 275, 4428-4444. [PubMed: 18671733]
Additional Comments
Modification by legionaminic acid (‘sialic acid-like’ nonulosonate sugar) of Gram-positive flagellar proteins is reported for the first time.
Year of Identification
2008
Year of Validation
2008
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.