Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC137
Organism Information
Organism Name
Clostridium difficile strain 630
Domain
Bacteria
Classification
Family: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Clostridium difficile is a gram-positive, anaerobic, spore-forming bacterium that produces TcdA and TcdB toxins causing severe tissue damage. It ia an opportunistic pathogen that is the major cause of antibiotic-associated diarrhoea and pseudomembranous colitis in humans. C. dificile infection can also result in abdominal pain, inflammation, and ulceration of the lining of the intestinal wall.
 
 
Gene Information
Gene Name
fliC (CD0239)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
FliC (Flagellin subunit)
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
290 AA
Subcellular Location
Surface associated
Function
Forms the filaments of bacterial flagella.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein
S141, S174, T183, S188, S205
Experimentally Validated Glycosite(s ) in Mature Protein
S141, S174, T183, S188, S205
Glycosite(s) Annotated Protein Sequence
>tr|Q18CX7|Q18CX7_CLOD6 Flagellin subunit OS=Clostridium difficile (strain 630)
GN=fliC PE=4 SV=1 MRVNTNVSALIANNQMGRNVNGQSKSMEKLSSGVRIKRAADDAAGLAISEKMRAQIK
GLD QAGRNVQDGISVVQTAEGSLEETGNILQRMRTLSLQSANEINNTEEREKIADELTQLKDE IERISSSTE
FNGKKLLDGTSS*(141)TIRLQVGASYGTNVSGTSNNNNEIKIQLVNTAS*(174) IMASAG ITT*(
183)
ASIGS*(188)MKAGGTTGTDAAKTMVS*(205)SLDAALKSLNSSRAKLGAQQNRLESTQNNLNNT
LE NVTAAESRIRDTDVASEMVNLSKMNILVQASQSMLAQANQQPQGVLQLLG
Sequence Around Glycosites (21 AA)
NGKKLLDGTSSTIRLQVGASY
EIKIQLVNTASIMASAGITTA
ASIMASAGITTASIGSMKAGG
SAGITTASIGSMKAGGTTGTD
TGTDAAKTMVSSLDAALKSLN
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Intact mass analysis with QTOF2-MS (hybrid quadrupole time of flight mass spectrometry)
Technique(s) used for Glycosylated Residue(s) Detection
Electron transfer dissociation (ETD) MS
Protein Glycosylation- Implication
Glycosylation of the flagellin protein is required for proper assembly and consequent motility.
 
 
Glycan Information
Glycan Annotation
(398-Da glycan) O-linked HexNAc residue, to which a methylated aspartic acid is linked via a phosphate bond. Flagellins from a number of C. difficile isolates from more recent outbreaks are modified in O linkage with a heterogeneous glycan containing up to five monosaccharide residues with masses of 204 (HexNAc), 146 (deoxyhexose), 160 (methylated deoxyhexose), and 192 (heptose).
Technique(s) used for Glycan Identification
MS/MS (tandem mass spectrometry), nESI-feCID-MS/MS (nano-electrospray ionization–front-end collision-induced dissociation MS/MS) analyses
 
 
Protein Glycosylation linked (PGL) gene(s)
Characterized Accessory Gene(s)
CD0240 glycosyltransferase. Its insertional mutagenesis abolished the flagellar filament production at the cell surface.
PGL Additional Links
 
 
Literature
Reference(s)
1) Twine, S.M., Reid, C.W., Aubry, A., McMullin, D.R., Fulton, K.M., Austin, J. and Logan, S.M. (2009) Motility and flagellar glycosylation in Clostridium difficile. J Bacteriol, 191, 7050-7062. [PubMed: 19749038]
Year of Identification
2009
Year of Validation
2009
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.