Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC139
Organism Information
Organism Name
Escherichia coli 2787 (O126:H27)
Domain
Bacteria
Classification
Family: Enterobacteriaceae
Order: "Enterobacteriales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
Organism Additional Information
Escherichia coli (Gram-negative) is the predominant facultative organism in the human intestine. It is responsible for a number of diseases like urinary tract infections, gastroenteritis (diarrhoea), meningitis, traveler's diarrhea and hemorrhagic colitis. There are a myriad of serotypes of pathogenic E. coli. Adhesion to the host cells is an important step in its pathogenesis. However, most strains are harmless and normal flora residing in the gut.
 
 
Gene Information
Gene Name
aidA (plasmid encoded)
 
 
Protein Information
Protein Name
Diffuse Adherence Adhesin (AIDA-I)
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|D7PPP4|D7PPP4_ECOLX Diffuse adherence adhesin OS=Escherichia coli GN=aidA PE
=4 SV=1
MNKAYSIIWSHSRQAWIVASELARGHGFVLAKNTLLVLAVVSTIGNAFAVNISGTVSSGGTVSS
GETQIVYSGGETSNATVNSGGTQIVNNGGKTTATTVNSSGSQNVGTSGATISTIVNSGGIQRVSSGGVASATNLSG
GAQNIYNLGHASNTVIFSGGNQTIFSGGITDSTNISSGGQQRVSSGGVASNTTINSSGAQNILSGGSAISTHISSG
GNQYISAGANATETIVNSGGFQRVNSGAVATGTVLSGGTQNVSSGGSAISTSVYNSGVQTVFAGATVTDTTVNSGG
NQNISSGGIVSETTVNVSGTQNIYSGGSALSANIKGSQIVNSEGTAINTLVSDGGYQHIRNGGIASGTIVNQSGYV
NISSGGYAESTIINSGGTLRVLSDGYARGTILNNSGRENVSNGGVSYNAMINTGGNQYIYSDGEATAAIVNTSGFQ
RINSGGTASGTKLSGGNQNVSSGGKAIDAEVYSGGKQTVYSGGEVSGTQIFNGGMVNVSGGTASGANVNLSGRLNA
FAGNVVGTILNQEGRQYVYSGATATSTVGNNEGREYVLSGGITDGTVLNSGGLQAVSSGGKASATVINEGGAQFVY
DGGQVTGTNIKNGGTIRVDSGASALNIALSSGGNLFTSTGATVTGTNHYGSFSVSQNHASNIVLENGGLLAVTSGG
TATDTTVNSAGRLRIDDGGTINGTTTINADGIVAGTNIQNDGNFILNLAENYDFETELSGSGVLVKDNTGIMTYAG
TLTQAQGVNVKNGGIIFDSAVVNADMAVNQNAYINISDQATINGSVNNNGSIVINNSIINGNITNDADLSFGTAKL
LSATVNGSLVNNKNIILNPTKESAGNTLTVSNYTGTPGSVISLGGVLEGDNSLTDRLVVKGNTSGQSDIVYVNEDG
SGGQTRDGINIISVEGNSDAEFSLKNRVVAGAYDYTLQKGNESGTDNKGWYLTSHLPTSDTRQYRPENGSYATNMA
LANSLFLMDLNERKQFRAMSDNTQPESASVWMKITGGRSSGKLNDGQNKTTTNQFINQLGGDIYKFHAEQLGDFTL
GIMGGYANAKGKTINYTSNKAARNTLDGYSVGVYGTWYQNGENATGLFAETWMQYNWFNASVKGDGLEEEKYNLNG
LTASAGGGYNLNVHTWTSPEGITGEFWLQPHLQAVWMGVTPDTHQEDNGTVVQGAGKNNIQTKAGIRASWKVKSTL
DKDTGREFRPYIEANWIHNTHEFGVKMSDDSQLLSGSRNQGEIKTGIEGVITQNLSVNGGVAYQAGGHGSNAISGA
LGIKYSF
Sequence length
1287 AA
Subcellular Location
Periplasm (Extracellular membrane associated)
Function
Self-associating autotransporters (SAAT). Adhesin involved in diffuse adherence. Able to confer a pattern of diffuse adherence on the surface of cultured epithelial cells.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
S102, S111, S116, S242, S252, S334, S391, S409, S540, S546, S559, S570, S577, S578, S583, T154
Experimentally Validated Glycosite(s ) in Mature Protein
S102, S111, S116, S242, S252, S334, S391, S409, S540, S546, S559, S570, S577, S578, S583, T154
Glycosite(s) Annotated Protein Sequence
>tr|D7PPP4|D7PPP4_ECOLX Diffuse adherence adhesin OS=Escherichia coli GN=aidA PE
=4 SV=1
MNKAYSIIWSHSRQAWIVASELARGHGFVLAKNTLLVLAVVSTIGNAFAVNISGTVSSGG
TVSSGETQIVYSGGETSNATVNSGGTQIVNNGGKTTATTVNS*(102)SGSQNVGTS*(111)GATIS*(1
16)
TIVN SGGIQRVSSGGVASATNLSGGAQNIYNLGHASNT*(154)VIFSGGNQTIFSGGITDSTNISSG
GQ QRVSSGGVASNTTINSSGAQNILSGGSAISTHISSGGNQYISAGANATETIVNSGGFQRV NS*(242)
GAVATGTVLS*(252)GGTQNVSSGGSAISTSVYNSGVQTVFAGATVTDTTVNSGGNQNISSGG IVSETTVN
VSGTQNIYSGGSALSANIKGSQIVNS*(334)EGTAINTLVSDGGYQHIRNGGIASGT IVNQSGYVNISSGG
YAESTIINSGGTLRVLS*(391)DGYARGTILNNSGRENVS*(409)NGGVSYNAMIN TGGNQYIYSDGE
ATAAIVNTSGFQRINSGGTASGTKLSGGNQNVSSGGKAIDAEVYSGGK QTVYSGGEVSGTQIFNGGMVNVSGGT
ASGANVNLSGRLNAFAGNVVGTILNQEGRQYVYS*(540)GATATS*(546)TVGNNEGREYVLS*(559)
GGITDGTVLNS*(570) GGLQAVS*(577)S*(578) GGKAS*(583)ATVINEGGAQFVYDGGQ
VTGTNIKNGGTIRVDSGASALNIALSSGGNLFTSTGATVTGTNHYGSFSVSQNHASNIVL ENGGLLAVTSGGTA
TDTTVNSAGRLRIDDGGTINGTTTINADGIVAGTNIQNDGNFILNL AENYDFETELSGSGVLVKDNTGIMTYAG
TLTQAQGVNVKNGGIIFDSAVVNADMAVNQNA YINISDQATINGSVNNNGSIVINNSIINGNITNDADLSFGTA
KLLSATVNGSLVNNKNII LNPTKESAGNTLTVSNYTGTPGSVISLGGVLEGDNSLTDRLVVKGNTSGQSDIVYV
NEDG SGGQTRDGINIISVEGNSDAEFSLKNRVVAGAYDYTLQKGNESGTDNKGWYLTSHLPTSD TRQYRPEN
GSYATNMALANSLFLMDLNERKQFRAMSDNTQPESASVWMKITGGRSSGKLN DGQNKTTTNQFINQLGGDIYKF
HAEQLGDFTLGIMGGYANAKGKTINYTSNKAARNTLDG YSVGVYGTWYQNGENATGLFAETWMQYNWFNASVKG
DGLEEEKYNLNGLTASAGGGYNLN VHTWTSPEGITGEFWLQPHLQAVWMGVTPDTHQEDNGTVVQGAGKNNIQT
KAGIRASWKV KSTLDKDTGREFRPYIEANWIHNTHEFGVKMSDDSQLLSGSRNQGEIKTGIEGVITQNLS VN
GGVAYQAGGHGSNAISGALGIKYSF
Sequence Around Glycosites (21 AA)
GGKTTATTVNSSGSQNVGTSG
NSSGSQNVGTSGATISTIVNS
QNVGTSGATISTIVNSGGIQR
VNSGGFQRVNSGAVATGTVLS
SGAVATGTVLSGGTQNVSSGG
ANIKGSQIVNSEGTAINTLVS
INSGGTLRVLSDGYARGTILN
ILNNSGRENVSNGGVSYNAMI
LNQEGRQYVYSGATATSTVGN
QYVYSGATATSTVGNNEGREY
GNNEGREYVLSGGITDGTVLN
GGITDGTVLNSGGLQAVSSGG
VLNSGGLQAVSSGGKASATVI
LNSGGLQAVSSGGKASATVIN
LQAVSSGGKASATVINEGGAQ
NIYNLGHASNTVIFSGGNQTI
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Aberrant mobility on SDS-polyacrylamide gel, labelling with digoxigenin (DIG) hydrazide after periodate oxidation. The glycan was not detectable by common lectins and could not be deglycosylated by a broad spectrum of glycosidases.
Technique(s) used for Glycosylated Residue(s) Detection
MS-MS (tandem mass spectrometry) and N-terminal sequencing of AIDA-I peptides
Protein Glycosylation- Implication
Glycosylation is required to ensure a normal conformation of AIDA-I. Glycans could be involved in receptor recognition making it essential for adhesion but not for autoaggregation or biofilm formation. It also provides increased resistance to degradation. Only the glycosylated form binds to cultured epithelial cells. Further unglycosylated AIDA-I is expressed in smaller amounts than its relatively thermostable glycosylated form. Unglycosylated AIDA-I is more sensitive to proteases and induces important extracytoplasmic stress.
 
 
Glycan Information
Glycan Annotation
Heterogenous multiple heptose residues (atleast 19 per protein molecule).
Technique(s) used for Glycan Identification
Gas chromatography and mass spectrometry after methanolysis and carbohydrate labelling.
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
aah (autotransporter-adhesin-heptosyltransferase), charcaterized based on gene deletion studies
OST Protein Name
Aah is the heptosyltransferase. Tib C (E. coli (ETEC) strain H10407) has sequence similarity with Aah gene and it can substitute function of Aah.
 
 
Literature
Reference(s)
1) Charbonneau, M.E., Girard, V., Nikolakakis, A., Campos, M., Berthiaume, F., Dumas, F., Lepine, F. and Mourez, M. (2007) O-linked glycosylation ensures the normal conformation of the autotransporter adhesin involved in diffuse adherence. J Bacteriol, 189, 8880-8889. [PubMed: 17951390]
2) Sherlock, O., Schembri, M.A., Reisner, A. and Klemm, P. (2004) Novel roles for the AIDA adhesin from diarrheagenic Escherichia coli: cell aggregation and biofilm formation. J Bacteriol, 186, 8058-8065. [PubMed: 15547278]
3) Moormann, C., Benz, I. and Schmidt, M.A. (2002) Functional substitution of the TibC protein of enterotoxigenic Escherichia coli strains for the autotransporter adhesin heptosyltransferase of the AIDA system. Infect Immun, 70, 2264-2270. [PubMed: 11953358]
4) Benz, I. and Schmidt, M.A. (2001) Glycosylation with heptose residues mediated by the aah gene product is essential for adherence of the AIDA-I adhesin. Mol Microbiol, 40, 1403-1413. [PubMed: 11442838]
Additional Comments
AIDA- I is primarily associated with pathogenic E. coli strains involved in neonatal and postweaning diarrhea in piglets.
The glycosylated peptides were identified in a region of the protein composed of imperfect 19-amino-acid repeats.
Glycosylation by heptoses represents a novel protein modification in eubacteria.
Sequon features: The N-terminal repeats of AIDA-I that contain multiple copies of the consensus sequence VXNSGG, might serve as acceptor sites for the AAH heptosyltransferase.
UniProtKB information is provided according to Ref. no. 1 in which glycosites have been confirmed.
Year of Identification
2001
Year of Validation
2007
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.