Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC140
Organism Information
Organism Name
Escherichia coli K12
Domain
Bacteria
Classification
Family: Enterobacteriaceae
Order: "Enterobacteriales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Escherichia coli (Gram-negative) is the predominant facultative organism in the human intestine. It is responsible for a number of diseases like urinary tract infections, gastroenteritis (diarrhoea), meningitis, traveler's diarrhea and hemorrhagic colitis. There are a myriad of serotypes of pathogenic E. coli. Adhesion to the host cells is an important step in its pathogenesis. However, most strains are harmless and normal flora residing in the gut.
 
 
Gene Information
Gene Name
flu
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Ag43α (Antigen 43 passenger domain)
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
>sp|P39180|AG43_ECOLI Antigen 43 OS=Escherichia coli (strain K12) GN=flu PE=1 SV
=3 MKRHLNTCYRLVWNHMTGAFVVASELARARGKRGGVAVALSLAAVTSLPVLAADIVVHPG ETVNGGTLANHD
NQIVFGTTNGMTISTGLEYGPDNEANTGGQWVQDGGTANKTTVTSGGL QRVNPGGSVSDTVISAGGGQSLQGRAV
NTTLNGGEQWMHEGAIATGTVINDKGWQVVKPG TVATDTVVNTGAEGGPDAENGDTGQFVRGDAVRTTINKNGRQ
IVRAEGTANTTVVYAGGD QTVHGHALDTTLNGGYQYVHNGGTASDTVVNSDGWQIVKNGGVAGNTTVNQKGRLQV
DAG GTATNVTLKQGGALVTSTAATVTGINRLGAFSVVEGKADNVVLENGGRLDVLTGHTATNT RVDDGGTLDVR
NGGTATTVSMGNGGVLLADSGAAVSGTRSDGKAFSIGGGQADALMLEKG SSFTLNAGDTATDTTVNGGLFTARGG
TLAGTTTLNNGAILTLSGKTVNNDTLTIREGDAL LQGGSLTGNGSVEKSGSGTLTVSNTTLTQKAVNLNEGTLTL
NDSTVTTDVIAQRGTALKL TGSTVLNGAIDPTNVTLASGATWNIPDNATVQSVVDDLSHAGQIHFTSTRTGKFVP
ATLK VKNLNGQNGTISLRVRPDMAQNNADRLVIDGGRATGKTILNLVNAGNSASGLATSGKGIQ VVEAINGATT
EEGAFVQGNRLQAGAFNYSLNRDSDESWYLRSENAYRAEVPLYASMLTQA MDYDRIVAGSRSHQTGVNGENNSVR
LSIQGGHLGHDNNGGIARGATPESSGSYGFVRLEG DLMRTEVAGMSVTAGVYGAAGHSSVDVKDDDGSRAGTVRD
DAGSLGGYLNLVHTSSGLWA DIVAQGTRHSMKASSDNNDFRARGWGWLGSLETGLPFSITDNLMLEPQLQYTWQG
LSLDD GKDNAGYVKFGHGSAQHVRAGFRLGSHNDMTFGEGTSSRAPLRDSAKHSVSELPVNWWVQ PSVIRTFSS
RGDMRVGTSTAGSGMTFSPSQNGTSLDLQAGLEARVRENITLGVQAGYAHS VSGSSAEGYNGQATLNVTF
Sequence length
1039 AA
Subcellular Location
Secreted
Function
Self-associating autotransporters (SAAT). It is the extracellular passenger domain of the E. coli autotransporter which represents a branch of the type V secretion pathway. Mediates bacterial autoaggregation (Ag43 interacts with Ag43 intercellularly) and biofilm formation as well as adhesion to and invasion of mammalian cells. It causes frizzy colony morphology and cell settling.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
(Signal pepide: 1-52; sequence beyond 551 is cleaved during secretion) T87, T113, S117, S135, T149, T150, T229, T232, T287/T288, S317, S332, S396, S406, S422, T487, S491, S503
Experimentally Validated Glycosite(s ) in Mature Protein
T35, T61, S65, S83, T97, T98, T177, T180, T235/T236, S265, S280, S344, S354, S370, T435, S439, S451
Glycosite(s) Annotated Protein Sequence
>sp|P39180|AG43_ECOLI Antigen 43 OS=Escherichia coli (strain K12) GN=flu PE=1 SV
=3 MKRHLNTCYRLVWNHMTGAFVVASELARARGKRGGVAVALSLAAVTSLPVLAADIVVHPG ETVNGGTLAN
HDNQIVFGTTNGMTIST*(87)GLEYGPDNEANTGGQWVQDGGTANKT*(113)TVTS*(117)GGL Q
RVNPGGSVSDTVIS*(135)AGGGQSLQGRAVNT*(149)T(150)LNGGEQWMHEGAIATGTVINDKGW
QVVKPG TVATDTVVNTGAEGGPDAENGDTGQFVRGDAVRTTINKNGRQIVRAEGT*(229)ANT*(232)
TVVYAGGD QTVHGHALDTTLNGGYQYVHNGGTASDTVVNSDGWQIVKNGGVAGNT*(287)T*(288)VNQK
GRLQVDAG GTATNVTLKQGGALVTS*(317)TAATVTGINRLGAFS*(332)VVEGKADNVVLENGGRLD
VLTGHTATNT RVDDGGTLDVRNGGTATTVSMGNGGVLLADSGAAVS*(396)GTRSDGKAFS*(406)IG
GGQADALMLEKG SS*(422)FTLNAGDTATDTTVNGGLFTARGGTLAGTTTLNNGAILTLSGKTVNNDTLTI
REGDAL LQGGSLT*(487)GNGS*(491)VEKSGSGTLTVS*(503)NTTLTQKAVNLNEGTLTLNDS
TVTTDVIAQRGTALKL TGSTVLNGAIDPTNVTLASGATWNIPDNATVQSVVDDLSHAGQIHFTSTRTGKFVPAT
LK VKNLNGQNGTISLRVRPDMAQNNADRLVIDGGRATGKTILNLVNAGNSASGLATSGKGIQ VVEAINGATT
EEGAFVQGNRLQAGAFNYSLNRDSDESWYLRSENAYRAEVPLYASMLTQA MDYDRIVAGSRSHQTGVNGENNSV
RLSIQGGHLGHDNNGGIARGATPESSGSYGFVRLEG DLMRTEVAGMSVTAGVYGAAGHSSVDVKDDDGSRAGTV
RDDAGSLGGYLNLVHTSSGLWA DIVAQGTRHSMKASSDNNDFRARGWGWLGSLETGLPFSITDNLMLEPQLQYT
WQGLSLDD GKDNAGYVKFGHGSAQHVRAGFRLGSHNDMTFGEGTSSRAPLRDSAKHSVSELPVNWWVQ PSVI
RTFSSRGDMRVGTSTAGSGMTFSPSQNGTSLDLQAGLEARVRENITLGVQAGYAHS VSGSSAEGYNGQATLNVTF
Sequence Around Glycosites (21 AA)
FGTTNGMTISTGLEYGPDNEA
WVQDGGTANKTTVTSGGLQRV
GGTANKTTVTSGGLQRVNPGG
PGGSVSDTVISAGGGQSLQGR
GQSLQGRAVNTTLNGGEQWMH
QSLQGRAVNTTLNGGEQWMHE
NGRQIVRAEGTANTTVVYAGG
QIVRAEGTANTTVVYAGGDQT
IVKNGGVAGNTTVNQKGRLQV
VKNGGVAGNTTVNQKGRLQVD
TLKQGGALVTSTAATVTGINR
VTGINRLGAFSVVEGKADNVV
VLLADSGAAVSGTRSDGKAFS
SGTRSDGKAFSIGGGQADALM
ADALMLEKGSSFTLNAGDTAT
GDALLQGGSLTGNGSVEKSGS
LQGGSLTGNGSVEKSGSGTLT
EKSGSGTLTVSNTTLTQKAVN
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Labelling with digoxigenin (DIG)-conjugated hydrazide. Subsequently, the DIG-labelled structures were detected with peroxidase-conjugated anti-DIG antibodies..
Technique(s) used for Glycosylated Residue(s) Detection
Automated LC-ESI–MS/MS (liquid chromatography electrospray ionization tandem mass spectrometry) with CID (collision induced dissociation) and ETD (electron transfer dissociation) after β-elimination.
Protein Glycosylation- Implication
Glycosylation protects Ag43α against native-state proteolysis and stabilizes it against thermal and chemical denaturation, and also increases its refolding rate. It reduces the stabilizing effect of Ca2+ ions, prevents Ca2+ to promote cell adhesion and inhibits the bacterial amyloid-forming ability of Ag43α.
 
 
Glycan Information
Glycan Annotation
Multiple heptose residues.
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
aah (autotransporter-adhesin-heptosyltransferase) charcaterized based on gene deletion studies
OST Protein Name
Aah is the heptosyltransferase. Tib C (E. coli (ETEC) strain H10407) has sequence similarity with Aah gene and it can substitute function of Aah.
 
 
Literature
Reference(s)
1) Knudsen, S.K., Stensballe, A., Franzmann, M., Westergaard, U.B. and Otzen, D.E. (2008) Effect of glycosylation on the extracellular domain of the Ag43 bacterial autotransporter: enhanced stability and reduced cellular aggregation. Biochem J, 412, 563-577. [PubMed: 18341480]
2) Sherlock, O., Dobrindt, U., Jensen, J.B., Munk Vejborg, R. and Klemm, P. (2006) Glycosylation of the self-recognizing Escherichia coli Ag43 autotransporter protein. J Bacteriol, 188, 1798-1807. [PubMed: 16484190]
Additional Comments
Ag43 protein is involved in phase variable biofilm formation.
The glycosylated peptides were identified in a region of the protein composed of imperfect 19-amino-acid repeats.
Glycosylation by heptoses represents a novel protein modification in eubacteria.
Year of Identification
2006
Year of Validation
2008
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.