Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC146
Organism Information
Organism Name
Geobacillus tepidamans GS5-97T
Domain
Bacteria
Classification
Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
sgtA
 
 
Protein Information
Protein Name
SgtA
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
>tr|Q58R21|Q58R21_9BACI SgtA OS=Geobacillus tepidamans GN=sgtA PE=4 SV=1 MSKKKAI
KLATASAIAASAFVAANPNASEAATNVDAVVSQAKAQMRNAYYTYSHTVTNTG EFADIKAVYAEYNKAKKAYADA
VALVKKAGGANKDAYLADLEATYEVYITSRVIPYIDAY NYAVKLDAMRQELQAAVDAKDLAKVEELYHKISYELK
SRTVILDRVYGQTTRDLLRSQFK AAAQQLRDSLIYDVTVSMKLKAAEEATNKGDLAAAEKALAEAQDALTKATAF
KADLTTKQ ATVKAAYEAKVAPAVVGVSAVNSRTVQIKFNKPIDASTVLVDKGTTDTSDDTLKTTSIVF TALDGQ
PAISQTDIKASLSDDKKTLTLVAANSDFFTKRYVVDIKNVKTTDGKDVPAYTTT IDTTDSVRPAVLSYSYADNGL
TLKVKFSEPLNSVGTVKLYDGTTEISVSPSFTAGSDEMT INLASSSVPVNKALTLKIFGAVDYNGNVINPNPAEL
TVMKTTVDTTKPTVQSVEAVNDKT VKVTFSEKLLGNPTIKIGGTTAASVSVDSTGLVYTATLNSAQLGIQAVEVS
SYTDLAGNV GDAYTKVVELKADTTAPKLVSSQVVKINGIENLVLTFDEEVTTQNNITVVSSNDYYVDEN NVRKQ
VGVTLTTNSTNFKLYNPVNGKSKSVALDISSLPKGTYTVTLPTGATALVKDLASN PNAYAEGKQITFVRGTDSLT
TKPALDTNVSTNGVEVVDNNTLRFTFTQNLDASALNLSNF NINGVALSKAVFDGATNKILVTLAPGANTWTGTHV
ITVSNIKNVSGIAMDTVTTTESMNE NVAPTFTATLTSADVIKVTFSEPVAHSTLSNAITGNNFTVKVDGTLNNVT
GVYTDSAATT PVSATGNTGYKTVYLKLATPVTDLTKPITVSATNLVDVSAEGASPTVVGNTVSSDVVNVA K
Sequence length
901 AA
Subcellular Location
Surface
Function
Surface layer glycoprotein
 
 
Glycosylation Status
Glycosylation Type
O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
S792
Experimentally Validated Glycosite(s ) in Mature Protein
S792
Glycosite(s) Annotated Protein Sequence
>tr|Q58R21|Q58R21_9BACI SgtA OS=Geobacillus tepidamans GN=sgtA PE=4 SV=1 MSKKKA
IKLATASAIAASAFVAANPNASEAATNVDAVVSQAKAQMRNAYYTYSHTVTNTG EFADIKAVYAEYNKAKKAYA
DAVALVKKAGGANKDAYLADLEATYEVYITSRVIPYIDAY NYAVKLDAMRQELQAAVDAKDLAKVEELYHKISY
ELKSRTVILDRVYGQTTRDLLRSQFK AAAQQLRDSLIYDVTVSMKLKAAEEATNKGDLAAAEKALAEAQDALTK
ATAFKADLTTKQ ATVKAAYEAKVAPAVVGVSAVNSRTVQIKFNKPIDASTVLVDKGTTDTSDDTLKTTSIVF
TALDGQPAISQTDIKASLSDDKKTLTLVAANSDFFTKRYVVDIKNVKTTDGKDVPAYTTT IDTTDSVRPAVLSY
SYADNGLTLKVKFSEPLNSVGTVKLYDGTTEISVSPSFTAGSDEMT INLASSSVPVNKALTLKIFGAVDYNGNV
INPNPAELTVMKTTVDTTKPTVQSVEAVNDKT VKVTFSEKLLGNPTIKIGGTTAASVSVDSTGLVYTATLNSAQ
LGIQAVEVSSYTDLAGNV GDAYTKVVELKADTTAPKLVSSQVVKINGIENLVLTFDEEVTTQNNITVVSSNDYY
VDEN NVRKQVGVTLTTNSTNFKLYNPVNGKSKSVALDISSLPKGTYTVTLPTGATALVKDLASN PNAYAEGK
QITFVRGTDSLTTKPALDTNVSTNGVEVVDNNTLRFTFTQNLDASALNLSNF NINGVALSKAVFDGATNKILVT
LAPGANTWTGTHVITVSNIKNVSGIAMDTVTTTESMNE NVAPTFTATLTS*(792)ADVIKVTFSEPVAHST
LSNAITGNNFTVKVDGTLNNVTGVYTDSAATT PVSATGNTGYKTVYLKLATPVTDLTKPITVSATNLVDVSAEG
ASPTVVGNTVSSDVVNVA K
Sequence Around Glycosites (21 AA)
VAPTFTATLTSADVIKVTFSE
Technique(s) used for Glycosylation Detection
Periodic acid-Schiff (PAS) staining and chemical deglycosylation
Technique(s) used for Glycosylated Residue(s) Detection
ESI-QTOF-MS (electrospray ionization quadrupole-time-of-flight mass spectrometry)
 
 
Glycan Information
Glycan Annotation
Linkage: β-D-Gal-Ser/Thr.
[→2)-α-L-Rhap-(1→3)-α-D-Fucp-(1→]n=~20. Rhamnose residue at the nonreducing end of the terminal repeating unit of the glycan chain is di-substituted. (R)-N-acetylmuramic acid found in an α-linkage to carbon 3 of the terminal rhamnose residue, serving as capping motif of an S-layer glycan. In addition, that rhamnose is substituted at position 2 with a β-N-acetylglucosamine residue. The S-layer glycan chains are bound via the trisaccharide core →2)-α-L-Rhap-(1→3)-α-L-Rhap-(1→3)-α-L-Rhap-(1→ to carbon 3 of β-D-galactose, which is attached to S and T residues.
BCSDB ID
Technique(s) used for Glycan Identification
HPAEC/PAD (high performance anion-exchange chromatography/pulsed amperometric detection), 1H and 13C NMR spectroscopy including 2D NOESY (nuclear Overhauser enhancement spectroscopy), HMBC (heteronuclear multiple bond correlation spectroscopy) and TOCSY (total correlation spectroscopy)
 
 
Literature
Reference(s)
1) Messner, P., Steiner, K., Zarschler, K. and Schaffer, C. (2008) S-layer nanoglycobiology of bacteria. Carbohydr Res, 343, 1934-1951. [PubMed: 18336801]
2) Zayni, S., Steiner, K., Pfostl, A., Hofinger, A., Kosma, P., Schaffer, C. and Messner, P. (2007) The dTDP-4-dehydro-6-deoxyglucose reductase encoding fcd gene is part of the surface layer glycoprotein glycosylation gene cluster of Geobacillus tepidamans GS5-97T. Glycobiology, 17, 433-443. [PubMed: 17202151]
3) Kahlig, H., Kolarich, D., Zayni, S., Scheberl, A., Kosma, P., Schaffer, C. and Messner, P. (2005) N-acetylmuramic acid as capping element of alpha-D-fucose-containing S-layer glycoprotein glycans from Geobacillus tepidamans GS5-97T. J Biol Chem, 280, 20292-20299. [PubMed: 15781455]
Additional Comments
Due to the high sequence homology of a region of SgtA containing a potential TQN sequon with that of the SgsE containing the glycosite T590, T583 in SgtA is suggested to be glycosylated. SgsE is the S-layer glycoprotein of Geobacillus stearothermophilus NRS 2004/3a.
Year of Identification
2005
Year of Validation
2007
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.