Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC148
Organism Information
Organism Name
Helicobacter (Campylobacter) pylori 1061/ J99
Domain
Bacteria
Classification
Family: Helicobacteraceae
Order: Campylobacterales
Class: Epsilonproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Helicobacter pylori is a Gram-negative, microaerophilic, human gastric pathogen classified by WHO as a Type 1 carcinogen. Its lipopolysaccharide (LPS) O antigen is responsible for its virulence. Lewis antigens on its O polysaccharides mimic glycan structures on human cells and interact with the C-type lectin DC-SIGN on dendritic cells, thereby down-regulating an inflammatory response. It also causes chronic type B gastritis (a prerequisite for duodenal ulcers) and is linked with mucosa-associated lymphoid tissue (MALT) and with B-cell MALT lymphomas.
 
 
Gene Information
Gene Name
flaA (jhp_0548)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Flagellin A (FlaA)
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
510 AA
Subcellular Location
Secreted
Function
Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella. Important for motility and virulence.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein
(Initiator Met removed) T181, T364, S208, S246, S354, S395, S405
Experimentally Validated Glycosite(s ) in Mature Protein
T180, T363, S207, S245, S353, S394, S404
Glycosite(s) Annotated Protein Sequence
>sp|P0A0S2|FLAA_HELPJ Flagellin A OS=Helicobacter pylori J99 GN=flaA PE=3 SV=2
MAFQVNTNINAMNAHVQSALTQNALKTSLERLSSGLRINKAADDASGMTVADSLRSQASS LGQAIANTNDGMGI
IQVADKAMDEQLKILDTVKVKATQAAQDGQTTESRKAIQSDIVRLI QGLDNIGNTTTYNGQALLSGQFTNKEFQ
VGAYSNQSIKASIGSTTSDKIGQVRIATGALI T*(181)ASGDISLTFKQVDGVNDVTLESVKVSS*(208
)
SAGTGIGVLAEVINKNSNRTGVKAYASVITTS DVAVQS*(246)GSLSNLTLNGIHLGNIADIKKNDSDG
RLVAAINAVTSETGVEAYTDQKGRLNLR SIDGRGIEIKTDSVSNGPSALTMVNGGQDLTKGSTNYGRLSLTRLD
AKSINVVS*(354)ASDSQH LGFT*(364)AIGFGESQVAETTVNLRDVTGNFNANVKSAS*(395)G
ANYNAVIAS*(405)GNQSLGSGVTTLRGA MVVIDIAESAMKMLDKVRSDLGSVQNQMISTVNNISITQVNV
KAAESQIRDVDFAEESAN FNKNNILAQSGSYAMSQANTVQQNILRLLT
Sequence Around Glycosites (21 AA)
QVRIATGALITASGDISLTFK
SASDSQHLGFTAIGFGESQVA
DVTLESVKVSSSAGTGIGVLA
VITTSDVAVQSGSLSNLTLNG
RLDAKSINVVSASDSQHLGFT
GNFNANVKSASGANYNAVIAS
SGANYNAVIASGNQSLGSGVT
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
DIG Glycan/Protein Double Labelling (DIG-hydrazide labeling after periodate oxidation) followed by Western blot using anti-DIG antibodies.
Technique(s) used for Glycosylated Residue(s) Detection
cLC/ESMS (capillary liquid chromatography electrospray mass spectrometry) and MS/MS (tandem mass spectrometry) after β-elimination with ammonium hydroxide
 
 
Glycan Information
Glycan Annotation
Pseudaminic acid (Pse5Ac7Ac, 5,7-diacetamido-3,5,7,9-tetradeoxy-L-glycero-L-manno-nonulosonic acid). A total of seven O-linked Pse5Ac7Ac residues are present in FlaA protein.
BCSDB ID
Technique(s) used for Glycan Identification
CE-ESMS (capillary electrophoresis-electrospray mass spectrometry), tandem mass spectrometry and precursor ion scanning with fe-CID (front-end collision-induced dissociation)
 
 
Protein Glycosylation linked (PGL) gene(s)
Predicted Accessory Gene(s)
The products of the neuA/flmD/flmH (HP0326a, 0326b, 0327) genes are likely involved in the enzymatic flagellin glycosylation pathway.
PGL Additional Links
 
 
Literature
Reference(s)
1) Schoenhofen, I.C., Lunin, V.V., Julien, J.P., Li, Y., Ajamian, E., Matte, A., Cygler, M., Brisson, J.R., Aubry, A., Logan, S.M. et al. (2006) Structural and functional characterization of PseC, an aminotransferase involved in the biosynthesis of pseudaminic acid, an essential flagellar modification in Helicobacter pylori. J Biol Chem, 281, 8907-8916. [PubMed: 16421095]
2) Schirm, M., Soo, E.C., Aubry, A.J., Austin, J., Thibault, P. and Logan, S.M. (2003) Structural, genetic and functional characterization of the flagellin glycosylation process in Helicobacter pylori. Mol Microbiol, 48, 1579-1592. [PubMed: 12791140]
3) Josenhans, C., Vossebein, L., Friedrich, S. and Suerbaum, S. (2002) The neuA/flmD gene cluster of Helicobacter pylori is involved in flagellar biosynthesis and flagellin glycosylation. FEMS Microbiol Lett, 210, 165-172. [PubMed: 12044670]
Year of Identification
2002
Year of Validation
2003
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.