Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC149
Organism Information
Organism Name
Lactobacillus plantarum A-1
Domain
Bacteria
Classification
Family: Lactobacillaceae
Order: Lactobacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
EMBL
 
 
Gene Information
Gene Name
bactA1
 
 
Protein Information
Protein Name
Plantaricin ASM1
UniProtKB/SwissProt ID
EMBL-CDS
UniProtKB Sequence
Sequence length
64 AA
Subcellular Location
Secreted
 
 
Glycosylation Status
Glycosylation Type
O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
(Signal peptide: 1-21) S61
Experimentally Validated Glycosite(s ) in Mature Protein
S40
Glycosite(s) Annotated Protein Sequence
>sp|C7G1H4|PASM1_LACPL Bacteriocin plantarican ASM1 OS=Lactobacillus plantarum G
N=bactA1 PE=1 SV=1 MSKLVKTLTVDEISKIQTNGGKPAWCWYTLAMCGAGYDSGTCDYMYSHCFGVKHSSG
GGG S*(61)YHC
Sequence Around Glycosites (21 AA)
GVKHSSGGGGSYHC
Technique(s) used for Glycosylation Detection
Difference between the theoretical and measured masses
Technique(s) used for Glycosylated Residue(s) Detection
Edman sequencing
 
 
Literature
Reference(s)
1) Stepper, J., Shastri, S., Loo, T.S., Preston, J.C., Novak, P., Man, P., Moore, C.H., Havlicek, V., Patchett, M.L. and Norris, G.E. (2011) Cysteine S-glycosylation, a new post-translational modification found in glycopeptide bacteriocins. FEBS Lett, 585, 645-650. [PubMed: 21251913]
Year of Identification
2011
Year of Validation
2011
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.