Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC151
Organism Information
Organism Name
Listeria (Erysipelothrix) monocytogenes CLIP23485
Domain
Bacteria
Classification
Family: Listeriaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Listeria monocytogenes is a Gram-positive bacterium that is the causative agent of a severe food-borne infection termed listeriosis. Meningitis, septicemia, spontaneous abortion, perinatal infections, and gastroenteritis symptomize listeriosis.
 
 
Gene Information
Gene Name
flaA ( lmo0690)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Flagellin FlaA
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
287 AA
Subcellular Location
Secreted
Function
Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein
T141, T145, T173, T175, S180
Experimentally Validated Glycosite(s ) in Mature Protein
T141, T145, T173, T175, S180
Glycosite(s) Annotated Protein Sequence
>sp|Q02551|FLAA_LISMO Flagellin OS=Listeria monocytogenes GN=flaA PE=3 SV=2 MKV
NTNIISLKTQEYLRKNNEGMTQAQERLASGKRINSSLDDAAGLAVVTRMNVKSTGLD AASKNSSMGIDLLQTAD
SALSSMSSILQRMRQLAVQSSNGSFSDEDRKQYTAEFGSLIKE LDHVADTTNYNNIKLLDQTAT*(141)GA
AT*(145)QVSIQASDKANDLINIDLFNAKGLSAGT*(173)IT*(175)LGSGS*(180) TVAGY
SALSVADADSSQQATEAIDELINNISNGRALLGAGMSRLSYNVSNVNNQSIATKA SASSIEDADMAAEMSEMTK
YKILTQTSISMLSQANQTPQMLTQLINS
Sequence Around Glycosites (21 AA)
NNIKLLDQTATGAATQVSIQA
LLDQTATGAATQVSIQASDKA
LFNAKGLSAGTITLGSGSTVA
NAKGLSAGTITLGSGSTVAGY
SAGTITLGSGSTVAGYSALSV
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
DIG glycan detection
Technique(s) used for Glycosylated Residue(s) Detection
Alkaline hydrolysis and MS/MS (tandem mass spectrometry)
 
 
Glycan Information
Glycan Annotation
Linkage: ╬▓-GlcNAc-Thr/Ser.
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
lmo0688
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
Lmo0688 (GmaR)
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
PGL Additional Links
 
 
Literature
Reference(s)
1) Shen, A., Kamp, H.D., Gr├╝ndling, A., Higgins, D.E. (2006) A bifunctional O-GlcNAc transferase governs flagellar motility through anti-repression. Genes Dev, 20, 3283-95. [PubMed: 17158746]
2) Schirm, M., Kalmokoff, M., Aubry, A., Thibault, P., Sandoz, M. and Logan, S.M. (2004) Flagellin from Listeria monocytogenes is glycosylated with beta-O-linked N-acetylglucosamine. J Bacteriol, 186, 6721-6727. [PubMed: 15466023]
Additional Comments
GmaR (lmo0688) is a glycosyltransferase with O-linked N-acetylglucosamine transferase (OGT) activity.
Year of Identification
2004
Year of Validation
2004
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.