Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC152
Organism Information
Organism Name
Mycobacterium bovis AN5
Domain
Bacteria
Classification
Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Mycobacterium bovis is the etiologic agent of bovine tuberculosis.
 
 
Gene Information
Gene Name
mpb83 (Mb2898)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Cell surface lipoprotein MPB83 (25/23-kDa antigen
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
220 AA
Subcellular Location
Surface (membrane associated)
Function
Major immunodominant antigen.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Thr) linked
Experimentally Validated Glycosite(s) in Full Length Protein
T48, T49
Experimentally Validated Glycosite(s ) in Mature Protein
T48, T49
Glycosite(s) Annotated Protein Sequence
>sp|P0CAX7|MP83_MYCBO Cell surface lipoprotein MPB83 OS=Mycobacterium bovis GN=m
pb83 PE=4 SV=1 MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVT*(48)T*(49)
AAMADPAADLI GRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLTSALSGKLNPDVNLVDTLNGG
EYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADL TVIGARDDLMVNNA
GLVCGGVHTANATVYMIDTVLMPPAQ
Sequence Around Glycosites (21 AA)
KPATSPAAPVTTAAMADPAAD
PATSPAAPVTTAAMADPAADL
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
Concanavalin A (ConA)-binding, DIG glycan detection (labeling with digoxigenin-succinyl-epsilon-amidocaproic acid hydrazide and anti-DIG antibody after periodate oxidation)
Technique(s) used for Glycosylated Residue(s) Detection
Q-TOF nanoelectrospray MS-MS (hybrid quadrupole orthogonal acceleration time of flight), deletion analysis and site-directed mutagenesis
Protein Glycosylation- Implication
Glycosylation may function either as a signal for cleavage or as a means of preventing amino-terminal degradation of the protein following cleavage from its acylated anchor. This is because the 23-kDa form of MPB83 is generated by proteolytic cleavage immediately before Thr48 from the mature acylated 25-kDa form.
 
 
Glycan Information
Glycan Annotation
Linkage: Man-Thr.
3 mannose units present with Man(1→3)Man linkage. The dominant glycoform identified for MPB83 is Thr48 substituted with a single mannose residue and Thr49 substituted with a Man(1→3)Man linkage. However, evidence for a heterogeneous array of glycoforms from Thr48(Man3) Thr49(Man0) through to Thr48(Man0)Thr49(Man3) has also been observed.
BCSDB ID
Technique(s) used for Glycan Identification
Dionex ion chromatography of sugars after their release by acid hydrolysis, FAB-MS (fast atom bombardment-mass spectrometry) of permethylated O-glycans after their release by reductive elimination, and GC-MS linkage analysis of the partially methylated alditol acetates, derived from the permethylated products of reductive elimination.
 
 
Literature
Reference(s)
1) Michell, S.L., Whelan, A.O., Wheeler, P.R., Panico, M., Easton, R.L., Etienne, A.T., Haslam, S.M., Dell, A., Morris, H.R., Reason, A.J. et al. (2003) The MPB83 antigen from Mycobacterium bovis contains O-linked mannose and (1-->3)-mannobiose moieties. J Biol Chem, 278, 16423-16432. [PubMed: 12517764]
2) Fifis, T., Costopoulos, C., Radford, A.J., Bacic, A. and Wood, P.R. (1991) Purification and characterization of major antigens from a Mycobacterium bovis culture filtrate. Infect Immun, 59, 800-807. [PubMed: 1900061]
Additional Comments
23-kDa is the predominant form of the antigen in the culture supernatant.
25/23-kDa antigen was misidentified as glycosylated form of MPB70. It is actually MPB83 antigen.
Year of Identification
1991
Year of Validation
2003
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.