Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC156
Organism Information
Organism Name
Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090)
Domain
Bacteria
Classification
Family: Neisseriaceae
Order: Neisseriales
Class: Betaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Neisseria gonorrhoeae is the etiologic agent of the human disease gonorrhoea. It is equipped with a variety of adherence factors that help it in the colonization of diverse microenvironments in the human host. The property of phase and antigenic variation displayed by its type IV pilin enables it to avoid immune system thereby initiating the disease.
 
 
Gene Information
Gene Name
NGO1371
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
CcoP
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
439 AA
Subcellular Location
Periplasm
Function
Cytochrome cbb3 oxidase subunit. EC=1.9.3.1.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
S337
Experimentally Validated Glycosite(s ) in Mature Protein
S337
Glycosite(s) Annotated Protein Sequence
>tr|Q5F718|Q5F718_NEIG1 Putative cytochrome c oxidase subunit OS=Neisseria gonor
rhoeae (strain ATCC 700825 / FA 1090) GN=NGO1371 PE=4 SV=1 MNATSQFTSNFWNIYI
AVIVLLSFIALAWLLLSQNVVKRPKKGEEVQTTGHEWDGIAEYD NPLPRWWFWLCVLTWLFGIGYLVMYPGVGD
YKGLLKWTSHNQYEKEVKKADEQYGKLYAK FADMPIEKVAKDPQAKQIAQNLFNTYCIQCHGSDAKGSKGFPNL
TDSDWLWGGDPDKIHE TIEKGRVATMPAWGPALGEEGVKDVAHYVMSLSKPKGQYDEERAARGQALFSGPPANC
FT CHGDKGQGIQGLGPNLTDDVWLWGGTQKSIIETITNGRSSQMPAWGHFLDKDKLHIMTAY VWGLSNKDGK
APVKKAEPAPAAEPAPSAPAEAAQAAS*(337)EAKPAAAEPKAEEKAAPAAKADG KQVYETVCAACHGNAI
PGIPHVGTKADWADRIKKGKDTLHKHAIEGFNTMPAKGGRGDLS DDEVKAAVDYMVNQSGGKF
Sequence Around Glycosites (21 AA)
SAPAEAAQAASEAKPAAAEPK
Technique(s) used for Glycosylation Detection
Immunoblotting with antiglycan antibodies
Technique(s) used for Glycosylated Residue(s) Detection
Substitution mutation analysis
 
 
Glycan Information
Glycan Annotation
O-AcHexDATDH (433 Da). DATDH is 2,4 diacetamido-2,4,6 trideoxyhexose.
Technique(s) used for Glycan Identification
LC-ESI-MS/MS with CID (liquid chromatography-electrospray ionization–tandem mass spectrometry with collision-induced dissociation)
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
NGO0085
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
PglB
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
OST Genome Context
PGL Additional Links
 
 
Literature
Reference(s)
1) Vik, A., Aas, F.E., Anonsen, J.H., Bilsborough, S., Schneider, A., Egge-Jacobsen, W. and Koomey, M. (2009) Broad spectrum O-linked protein glycosylation in the human pathogen Neisseria gonorrhoeae. Proc Natl Acad Sci U S A, 106, 4447-4452. [PubMed: 19251655]
Additional Comments
Sequon feature: S/T plus low complexity region.
Year of Identification
2009
Year of Validation
2009
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.