Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC161
Organism Information
Organism Name
Pedobacter heparinus (Flavobacterium heparinum)
Domain
Bacteria
Classification
Family: Sphingobacteriaceae
Order: "Sphingobacteriales"
Class: "Sphingobacteria"
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Pedobacter heparinus is a Gram-negative, nonpathogenic soil organism.
 
 
Gene Information
Gene Name
hep A
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Heparin lyase I or Heparinase I
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
384 AA
Subcellular Location
Periplasm
Function
GAG lyase. EC= 4.2.2.7. It has been assigned to the polysaccharide lyase family PL13. Degrades heparin and heparan sulfate. Also implicated in the release of heparin-bound growth factors from the extracellular matrix.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
S39
Experimentally Validated Glycosite(s ) in Mature Protein
S39
Glycosite(s) Annotated Protein Sequence
>sp|Q05819|HEP1_PEDHE Heparin lyase I OS=Pedobacter heparinus PE=1 SV=1 MKKQILY
LIVLQQLFLCSAYAQQKKSGNIPYRVNVQADS*(39)AKQKAIIDNKWVAVGINKPYA LQYDDKLRFNGKPS
YRFELKAEDNSLEGYAAGETKGRTELSYSYATTNDFKKFPPSVYQN AQKLKTVYHYGKGICEQGSSRSYTFSVY
IPSSFPDNATTIFAQWHGAPSRTLVATPEGEI KTLSIEEFLALYDRMIFKKNIAHDKVEKKDKDGKITYVAGKP
NGWKVEQGGYPTLAFGFS KGYFYIKANSDRQWLTDKADRNNANPENSEVMKPYSSEYKTSTIAYKMPFAQFPKD
CWIT FDVAIDWTKYGKEANTILKPGKLDVMMTYTKNKKPQKAHIVNQQEILIGRNDDDGYYFKF GIYRVGNS
TVPVTYNLSGYSETAR
Sequence Around Glycosites (21 AA)
IPYRVNVQADSAKQKAIIDNK
Technique(s) used for Glycosylation Detection
Presence of multiple isoforms in the RPHPLC (reverse-phase high pressure liquid chromatography) profile, and mass excess (approx. 1.1 kDa) detected using mass spectrometry.
Technique(s) used for Glycosylated Residue(s) Detection
NMR and mass spectrometry
 
 
Glycan Information
Glycan Annotation
Linkage: Man-Ser.
Branched heptasaccharide is: galactose-β(1–4)[galactose-α(1–3)](2-O-Me)fucose-β(1–4)xylose-β (1–4)glucuronic acid-α(1–2)[rhamnose-α(1–4)]mannose-α(1-O)Ser.
Technique(s) used for Glycan Identification
Combination of enzymatic digestion, NMR and mass spectroscopy.
 
 
Protein Glycosylation linked (PGL) gene(s)
Characterized Accessory Gene(s)
Information currently not available with us.
PGL Additional Links
 
 
Literature
Reference(s)
1) Shaya, D., Tocilj, A., Li, Y., Myette, J., Venkataraman, G., Sasisekharan, R. and Cygler, M. (2006) Crystal structure of heparinase II from Pedobacter heparinus and its complex with a disaccharide product. J Biol Chem, 281, 15525-15535. [PubMed: 16565082]
2) Godavarti, R. and Sasisekharan, R. (1996) A comparative analysis of the primary sequences and characteristics of heparinases I, II, and III from Flavobacterium heparinum. Biochem Biophys Res Commun, 229, 770-777. [PubMed: 8954971]
3) Huang L., van Halbeek H., Eggimann B., Zimmermannn J. (1995) Structural characterization of the novel O-linked carbohydrate structure of Flavobacterium heparinum heparinase I. Glycobiology 5, 712-712.
4) Sasisekharan, R., Bulmer, M., Moremen, K.W., Cooney, C.L. and Langer, R. (1993) Cloning and expression of heparinase I gene from Flavobacterium heparinum. Proc Natl Acad Sci U S A, 90, 3660-3664. [PubMed: 8475114]
Additional Comments
Sequon features: Asp-Ser consensus sequon is found in this protein.
Post translational modification was detected as early as 1993 but the glycosylation was confirmed in 1995.
Year of Identification
1995
Year of Validation
1995
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.