Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC164
Organism Information
Organism Name
Pedobacter heparinus (strain ATCC 13125 / DSM 2366 / NCIB 9290)
Domain
Bacteria
Classification
Family: Sphingobacteriaceae
Order: "Sphingobacteriales"
Class: "Sphingobacteria"
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
Pedobacter heparinus is a Gram-negative, nonpathogenic soil organism.
 
 
Gene Information
Gene Name
cslB (Phep_0789)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Chondroitinase-B
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
506 AA
Subcellular Location
Periplasm
Function
GAG lyase. Cleaves the glycosaminoglycan, dermatan sulfate. EC= 4.2.2.19.
 
 
Protein Structure
PDB ID
 
 
Glycosylation Status
Glycosylation Type
O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
S234
Experimentally Validated Glycosite(s ) in Mature Protein
S234
Glycosite(s) Annotated Protein Sequence
>sp|Q46079|CSLB_PEDHD Chondroitinase-B OS=Pedobacter heparinus (strain ATCC 1312
5 / DSM 2366 / NCIB 9290) GN=cslB PE=1 SV=2 MKMLNKLAGYLLPIMVLLNVAPCLGQVVASN
ETLYQVVKEVKPGGLVQIADGTYKDVQLI VSNSGKSGLPITIKALNPGKVFFTGDAKVELRGEHLILEGIWFKD
GNRAIQAWKSHGPGL VAIYGSYNRITACVFDCFDEANSAYITTSLTEDGKVPQHCRIDHCSFTDKITFDQVINL
N NTARAIKDGSVGGPAMYHRVDHCFFSNPQKPGNAGGGIRIGYYRNDIGRCLVDS*(234)NLFMRQ DSE
AEIITSKSQENVYYGNTYLNCQGTMNFRHGDHQVAINNFYIGNDQRFGYGGMFVWGS RHVIACNYFELSETIKS
RGNAALYLNPGAMASEHALAFDMLIANNAFINVNGYAIHFNPL DERRKEYCAANRLKFETPHQLMLKGNLFFKD
KPYVYPFFKDDYFIAGKNSWTGNVALGVE KGIPVNISANRSAYKPVKIKDIQPIEGIALDLNALISKGITGKPL
SWDEVRPYWLKEMPG TYALTARLSADRAAKFKAVIKRNKEH
Sequence Around Glycosites (21 AA)
RNDIGRCLVDSNLFMRQDSEA
Technique(s) used for Glycosylation Detection
Deduced Crystal structure
Technique(s) used for Glycosylated Residue(s) Detection
Crystallographic analysis (electron density maps)
 
 
Glycan Information
Glycan Annotation
Linkages: Man- Ser.
The approx. weight of attached glycan was 1180 Da.
Branched heptasaccharide is: galactose-β(1–4)[galactose-α(1–3)](2-O-Me)fucose-β(1–4)xylose-β (1–4)glucuronic acid-α(1–2)[rhamnose-α(1–4)]mannose-α(1-O)Ser.
Technique(s) used for Glycan Identification
Crystallographic analysis (electron density maps)
 
 
Protein Glycosylation linked (PGL) gene(s)
Characterized Accessory Gene(s)
Information currently not available with us.
PGL Additional Links
 
 
Literature
Reference(s)
1) Michel, G., Pojasek, K., Li, Y., Sulea, T., Linhardt, R.J., Raman, R., Prabhakar, V., Sasisekharan, R. and Cygler, M. (2004) The structure of chondroitin B lyase complexed with glycosaminoglycan oligosaccharides unravels a calcium-dependent catalytic machinery. J Biol Chem, 279, 32882-32896. [PubMed: 15155751]
2) Huang, W., Matte, A., Li, Y., Kim, Y.S., Linhardt, R.J., Su, H. and Cygler, M. (1999) Crystal structure of chondroitinase B from Flavobacterium heparinum and its complex with a disaccharide product at 1.7 A resolution. J Mol Biol, 294, 1257-1269. [PubMed: 10600383]
Additional Comments
Sequon features: Identified glycosylation sequon features: Consensus sequon observed Asp-Ser or Asp-Thr-Thr, at turns.
Year of Identification
1999
Year of Validation
1999
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.