Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC169
Organism Information
Organism Name
Pseudomonas aeruginosa PAO1
Domain
Bacteria
Classification
Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
This Gram-negative opportunistic pathogen produces LecA and LecB virulence factors at high levels. It is involved in chronic airway infections. These virulence factors have been demonstrated to play a role in P. aeruginosa-induced otitis externa diffusa and cystic fibrosis.
 
 
Gene Information
Gene Name
lecB (PA3361)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Lectin LecB (PA-IIL is old name)
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
115 AA
Subcellular Location
Periplasm or outer membrane
Function
LecB is a fucose-/mannose-specific lectin. It may help in the adhesion of P. aeruginosa cells to the receptors and facilitate biofilm formation resulting in host tissue colonization. This virulence factor has an important role in human infection. It inhibits the ciliary beating and hence defence mechanism of the lung. It is involved in cystic fibrosis.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
N (Asn) linked
Experimentally Validated Glycosite(s) in Full Length Protein
N22
Experimentally Validated Glycosite(s ) in Mature Protein
N22
Glycosite(s) Annotated Protein Sequence
>tr|Q9HYN5|Q9HYN5_PSEAE Fucose-binding lectin PA-IIL OS=Pseudomonas aeruginosa G
N=lecB PE=1 SV=1 MATQGVFTLPANTRFGVTAFAN*(22)SSGTQTVNVLVNNETAATFSGQSTNNAVI
GTQVLNSGS SGKVQVQVSVNGRPSDLVSAQVILTNELNFALVGSEDGTDNDYNDAVVVINWPLG
Sequence Around Glycosites (21 AA)
NTRFGVTAFANSSGTQTVNVL
Technique(s) used for Glycosylation Detection
Deglycosylation with N-glycosidase F (PNGase F)
Technique(s) used for Glycosylated Residue(s) Detection
Site-directed mutagenesis (N22A)
Protein Glycosylation- Implication
LecB N glycosylation seems to be important for its production and transport to the outer membrane.
 
 
Literature
Reference(s)
1) Bartels, K.M., Funken, H., Knapp, A., Brocker, M., Bott, M., Wilhelm, S., Jaeger, K.E. and Rosenau, F. (2011) Glycosylation is required for outer membrane localization of the lectin LecB in Pseudomonas aeruginosa. J Bacteriol, 193, 1107-1113. [PubMed: 21217000]
Additional Comments
A LecB-deficient P. aeruginosa strain has been shown to be impaired in biofilm formation.
Year of Identification
2011
Year of Validation
2011
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.