Total Record - 1

Print this rrecord

 
ProGlyProt ID
BC170
Organism Information
Organism Name
Pseudomonas aeruginosa PAO1
Domain
Bacteria
Classification
Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI)
 
 
Genome Sequence(s)
GenBank
EMBL
Organism Additional Information
This Gram-negative opportunistic pathogen is responsible for nosocomial pneumonia. Its virulence factors include exotoxins, proteases, lipases, lipopolysaccharide (LPS), pili, and flagellin protein.
 
 
Gene Information
Gene Name
fliC (PA1092)
NCBI Gene ID
GenBank Gene Sequence
 
 
Protein Information
Protein Name
Type b Flagellin
UniProtKB/SwissProt ID
NCBI RefSeq
EMBL-CDS
UniProtKB Sequence
Sequence length
488 AA
Subcellular Location
Secreted
Function
Flagellin is the subunit protein which polymerizes to form the filaments of bacterial flagella. It has been shown to have a role in the stimulation of inflammatory response via Toll-like receptor 5.
 
 
Protein Structure
Homology Model
Homology Model File
 
 
Glycosylation Status
Glycosylation Type
O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein
(Initiator Met removed) S192, S196
Experimentally Validated Glycosite(s ) in Mature Protein
S191, S195
Glycosite(s) Annotated Protein Sequence
>sp|P72151|FLICB_PSEAE B-type flagellin OS=Pseudomonas aeruginosa GN=fliC PE=1 S
V=2 MALTVNTNIASLNTQRNLNASSNDLNTSLQRLTTGYRINSAKDDAAGLQISNRLSNQISG LNVATRNAN
DGISLAQTAEGALQQSTNILQRIRDLALQSANGSNSDADRAALQKEVAAQQ AELTRISDTTTFGGRKLLDGSFG
TTSFQVGSNAYETIDISLQNASASAIGSYQVGSNGAG TVASVAGTATAS*(192)GIAS*(196)GTVNL
VGGGQVKNIAIAAGDSAKAIAEKMDGAIPNLSARARTVF TADVSGVTGGSLNFDVTVGSNTVSLAGVTSTQDLA
DQLNSNSSKLGITASINDKGVLTIT SATGENVKFGAQTGTATAGQVAVKVQGSDGKFEAAAKNVVAAGTAATTT
IVTGYVQLNSP TAYSVSGTGTQASQVFGNASAAQKSSVASVDISTADGAQNAIAVVDNALAAIDAQRADLG A
VQNRFKNTIDNLTNISENATNARSRIKDTDFAAETAALSKNQVLQQAGTAILAQANQLP QAVLSLLR
Sequence Around Glycosites (21 AA)
VASVAGTATASGIASGTVNLV
AGTATASGIASGTVNLVGGGQ
Glycosite Sequence Logo
Glycosite Sequence Logo
Technique(s) used for Glycosylation Detection
NanoES-MS (nanoelectrospray mass spectrometry) for intact mass analysis
Technique(s) used for Glycosylated Residue(s) Detection
LC-ES-MS/MS (liquid chromatography electrospray tandem mass spectrometry) analysis of chymotryptic or tryptic digests of the protein after β-elimination with ammonium hydroxide.
 
 
Glycan Information
Glycan Annotation
Linkage: Deoxyhexose-Ser.
(356 Da) A single deoxyhexose monosaccharide linked to a unique modification of mass 209 Da which contains a phosphate moiety.
Technique(s) used for Glycan Identification
Intact mass analysis of flagellin by nanoelectrospray MS and LC-nES-MS/MS (liquid chromatography-nanoelectrospray tandem mass spectrometry) analysis of chymotryptic or tryptic digests of the protein.
 
 
Protein Glycosylation linked (PGL) gene(s)
OST Gene Name
pilO (tfpO)
OST NCBI Gene ID
OST GenBank Gene Sequence
OST Protein Name
PilO (TfpO)
OST UniProtKB/ SwissProt ID
OST NCBI RefSeq
OST EMBL-CDS
OST UniProtKB Sequence
OST EC Number (BRENDA)
OST Genome Context
Characterized Accessory Gene(s)
FgtA (PA1091) is the glycosyltransferase that adds the deoxyhexose to the protein. PA1088 enzyme attaches the 209-Da modification to the deoxyhexose. PA1088, PA1089, PA1090, PA1091 constitute the flagellin glycosylation island.
PGL Additional Links
 
 
Literature
Reference(s)
1) Verma, A., Schirm, M., Arora, S.K., Thibault, P., Logan, S.M. and Ramphal, R. (2006) Glycosylation of b-Type flagellin of Pseudomonas aeruginosa: structural and genetic basis. J Bacteriol, 188, 4395-4403. [PubMed: 16740946]
Year of Identification
2006
Year of Validation
2006
 
 
Copyright @ 2011 IMTECH
This site is best viewed in Mozilla Firefox, Internet Explorer 6 and above at screen resolution of 1024 x 768 and above.