ProGP100

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP100
Validation Status Uncharacterized
Organism Information
Organism NameSerpulina (Treponema) hyodysenteriae
Domain Bacteria
Classification Family: "Brachyspiraceae"
Order: Spirochaetales
Class: Spirochaetes
Division or phylum: "Spirochaetes" or "Spirochaetae"
Taxonomic ID (NCBI) 159
Genome Sequence(s)
EMBL X63006
Gene Information
Gene NameflaA1
Protein Information
Protein NamePF sheath protein (44 kDa)
UniProtKB/SwissProt ID P32520
EMBL-CDSCAA44735.1
UniProtKB Sequence >sp|P32520|FLAA1_TREHY Flagellar filament outer layer protein flaA1 OS=Treponema hyodysenteriae GN=flaA1 PE=1 SV=1 MKKLFVVLTSIFIAASAYGLTNSTLIDFALTGNADNLQAGEGDTNEVVPVAENLYNDNWV VWLNESARLTENRRNSYVTNVDSKGNNGAWEAGKVLGVRVHFPLAAWNSYALVKPVYELE MYGGADGTKYTEGKGVIHNVGEIKSISSWVYGRNYLISYFVNLQNEFGELKSYPMGTVYF NGWRQVRWENREYLPNVRDRVLVREPLYPRMIPSVKLDSLGFYRTKDTKGGDFITYVKDV TLEYDVVVVDFEEDIDDEATWQLLKTENDRKQAIESARIREQAELRDLEQRRIGDGTAAD QGAAANTGAADTGAAQEQAQ
Sequence length 320 AA
Subcellular LocationPeriplasm (Outer membrane)
Function Periplasmic flagellar sheath protein is a species-specific glycoprotein antigen. May be an important target for the host immune response.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionGlycoprotein staining (DIG glycan detection kit), deglycosylation with N-glycosidase F.
Literature
Year of Identification1993
Year of Identification Month Wise1993.12
Reference1) Li, Z., Dumas, F., Dubreuil, D. and Jacques, M. (1993) A species-specific periplasmic flagellar protein of Serpulina (Treponema) hyodysenteriae. J Bacteriol, 175, 8000-8007. [PubMed: 8253687]
Author Jacques, M.
Research GroupDépartement de Pathologie et Microbiologie, Faculté de Médecine Vétérinaire, Université de Montréal, Saint-Hyacinthe, Québec, Canada.
Corresponding Author Li, Z., Dumas, F., Dubreuil, D. Jacques, M.
ContactDépartement de Pathologie et Microbiologie, Faculté de Médecine Vétérinaire, Université de Montréal, Saint-Hyacinthe, Québec, Canada.