ProGP100

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP100
Validation Status Uncharacterized
Organism Information
Organism NameSerpulina (Treponema) hyodysenteriae
Domain Bacteria
Classification Family: "Brachyspiraceae"
Order: Spirochaetales
Class: Spirochaetes
Division or phylum: "Spirochaetes" or "Spirochaetae"
Taxonomic ID (NCBI) 159
Genome Sequence(s)
GenBank X63006
EMBL X63006
Gene Information
Gene NameflaA1
Protein Information
Protein NamePF sheath protein (44 kDa)
UniProtKB/SwissProt ID P32520
EMBL-CDSCAA44735.1
UniProtKB Sequence >sp|P32520|FLAA1_TREHY Flagellar filament outer layer protein flaA1 OS=Treponema hyodysenteriae GN=flaA1 PE=1 SV=1 MKKLFVVLTSIFIAASAYGLTNSTLIDFALTGNADNLQAGEGDTNEVVPVAENLYNDNWV VWLNESARLTENRRNSYVTNVDSKGNNGAWEAGKVLGVRVHFPLAAWNSYALVKPVYELE MYGGADGTKYTEGKGVIHNVGEIKSISSWVYGRNYLISYFVNLQNEFGELKSYPMGTVYF NGWRQVRWENREYLPNVRDRVLVREPLYPRMIPSVKLDSLGFYRTKDTKGGDFITYVKDV TLEYDVVVVDFEEDIDDEATWQLLKTENDRKQAIESARIREQAELRDLEQRRIGDGTAAD QGAAANTGAADTGAAQEQAQ
Sequence length 320 AA
Subcellular LocationPeriplasm (Outer membrane)
Function Periplasmic flagellar sheath protein is a species-specific glycoprotein antigen. May be an important target for the host immune response.
Glycosylation Status
Technique(s) used for Glycosylation DetectionGlycoprotein staining (DIG glycan detection kit), deglycosylation with N-glycosidase F.
Literature
Year of Identification1993
Year of Identification Month Wise1993.12
ReferenceLi, Z., Dumas, F., Dubreuil, D. and Jacques, M. (1993) A species-specific periplasmic flagellar protein of Serpulina (Treponema) hyodysenteriae. J Bacteriol, 175, 8000-8007. [PubMed: 8253687]
Author Jacques, M.
Research GroupDepartment of Pathology and Microbiology, Faculty of Veterinary Medicine, University of Montreal, Saint-Hyacinthe, Quebec, Canada.
Corresponding Author Li, Z., Dumas, F., Dubreuil, D. Jacques, M.
ContactDepartment of Pathology and Microbiology, Faculty of Veterinary Medicine, University of Montreal, Saint-Hyacinthe, Quebec, Canada.