ProGP102

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP102
Validation Status Uncharacterized
Organism Information
Organism NameNatroalba (formerly Natronobacterium) magadii
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 547559
Genome Sequence(s)
GenBank CP001932.1
EMBL CP001932
Gene Information
Gene NameflaB1 (Nmag_2862)
NCBI Gene ID 8825721
Protein Information
Protein NameFlagellin B1
UniProtKB/SwissProt ID Q9P9I3
NCBI RefSeq YP_003480977.1
EMBL-CDSADD06415.1
UniProtKB Sequence >sp|Q9P9I3|FLAB1_NATMM Flagellin B1 OS=Natrialba magadii (strain ATCC 43099 / DSM 3394 / NCIMB 2190 / MS3) GN=flaB1 PE=3 SV=2 MFEQNDDRDRGQVGIGTLIVFIAMVLVAAIAAGVLINTAGMLQTQAEATGEESTDQVSDR LDIVSVSGDVDDPDDPTQINNISMVTATAPGSDPVDLNQTTAQFIGEGGEEMFNLSHEGV FINSIQGVSDEPDNNVLTESSDRAEVVFELDGAPGSYDIGYEALDESERLTVILTTDAGA STEQEIRVPSTFIEDEESVRL
Sequence length 201 AA
Subcellular LocationSurface
Literature
Year of Identification1994
Year of Identification Month Wise1994.01
Reference1) Serganova, I., Ksenzenko, V., Serganov, A., Meshcheryakova, I., Pyatibratov, M., Vakhrusheva, O., Metlina, A. and Fedorov, O. (2002) Sequencing of flagellin genes from Natrialba magadii provides new insight into evolutionary aspects of archaeal flagellins. J Bacteriol, 184, 318-322. [PubMed: 11741874]
Author Serganova, I., Ksenzenko, V., Serganov, A., Meshcheryakova, I., Pyatibratov, M., Vakhrusheva, O., Metlina, A. Fedorov, O.
Research GroupInstitute of Protein Research, Russian Academy of Sciences, Pushchino, Moscow Region 142290, Russia.
Corresponding Author Fedorov, O.
ContactInstitute of Protein Research, Russian Academy of Sciences, Pushchino, Moscow Region 142290, Russia.
ReferenceFedorov OV, Paytibratov MG, Kostyukova AS, Osina NK, Tarasov VY. (1994) Protofilament as a Structural Element of Flagella of Haloalkalophilic Archaebacteria. Can J Microbiol, 40, 45.
AuthorFedorov OV, Paytibratov MG, Kostyukova AS, Osina NK, Tarasov VY. (1994) Protofilament as a Structural Element of Flagella of Haloalkalophilic Archaebacteria. Can J Microbiol, 40, 45.