ProGP105

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP105
Validation Status Uncharacterized
Organism Information
Organism NameThermoanaerobacter thermohydrosulfuricus L111-69 and L110-69
Domain Bacteria
Classification Family: Thermoanaerobacteraceae
Order: Thermoanaerobacterales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1516
Genome Sequence(s)
GenBank FJ656210
EMBL FJ656210
Gene Information
Gene NamesttA
Protein Information
Protein NameS-layer glycoprotein
UniProtKB/SwissProt ID C0L3L9
EMBL-CDSACN25024.1
UniProtKB Sequence >tr|C0L3L9|C0L3L9_THETY S-layer protein OS=Thermoanaerobacter thermohydrosulfuricus GN=sttA PE=4 SV=1 MLKRKLLAFVIVVAMLMSIMAPGFAFNYVTAPGTTPSSSNTVFSPGTTTQSDYTIVFEKN TAKVGDMVSLVIKVLDKEGKVVTDKKVLETIYKSGLTLNADPRTLVFDTNRSGWIDTNDG SLISATVNDAVYQTAYPVNNITTTDIRILPSSDVTGFVVASPGTVQFGFISAGQMSFYVA NYGRVWVTGSPSIIIDGQSKSVNYDDARLYLSGAAPNVSYLSGNTNPLETYPETVLITVP GANYNSAAKAVLTKDDKVLAIIDLVNSAKNINNAKDINNDGIVDGYKVVLPPMSAGHKYV LTVYNEVNYSNWEFGYGRNYYSVGAVNITPQAAKFELVAPADKVLAAGISDPVTFTLNDK LPNGNTSADNKNLAVDFAKFVRFTVLKSDNKTKDTEVKYVDANEKIANGSWYLVTDDGLK AVSLDTNNNIVLGDPVANSYEKDSGKITVKAKIPNGDYLKIEAAYTDYVGNLYEVKKLQD FEETFVVANLEAKPGTLTMEPSTINANEYRNVKFTVKDVHGNPVSGAEIKFSSPIVYLGG TGSTAVGNVGTAVKTGDDGTVTATLFSAFPTSIAVSVSVPVEKTLTLTINPSQQTGATVV FTIGSDKYTVNGVEKTMDAAPYVKDGRTLVPARYIADAINARSYYDQDTKVVTFVKGDTI VKFTLGSNKMQVIKNGVVVATQTMETKATTVDASGKDVGRTFILARYLAEAFGYKVDYAK DASGVETVTIY
Sequence length 731 AA
Subcellular LocationSurface
Function Structural component of the surface layer.
Glycosylation Status
Glycosylation Type O- (Tyr) linked
Technique(s) used for Glycosylation DetectionChemical deglycosylation with TFMS
Glycan Information
Glycan Annotation Linkage: β-Gal-Tyr. Terminal (capping) 3-O-methyl-rhamnose. The glycan chain 3-OMeLRhapα1-[4DManpα1-3LRhapα1]n~27-4DManpα1-3LRhapα1-3LRhapα1-3LRhapα1-3DGalpβ1-O-Tyr, is present.
BCSDB ID22444, 22503, 22504
Literature
Year of Identification1994
Year of Identification Month Wise1994.03
ReferenceBock, K., Schuster-Kolbe, J., Altman, E., Allmaier, G., Stahl, B., Christian, R., Sleytr, U.B. and Messner, P. (1994) Primary structure of the O-glycosidically linked glycan chain of the crystalline surface layer glycoprotein of Thermoanaerobacter thermohydrosulfuricus L111-69. Galactosyl tyrosine as a novel linkage unit. J Biol Chem, 269, 7137-7144. [PubMed: 8125923]
AuthorBock, K., Schuster-Kolbe, J., Altman, E., Allmaier, G., Stahl, B., Christian, R., Sleytr, U.B. and Messner, P
Research GroupDepartment of Chemistry, Carlsberg Laboratory, Valby, Copenhagen, Denmark.
Corresponding Author Messner, P
ContactDepartment of Chemistry, Carlsberg Laboratory, Valby, Copenhagen, Denmark.