ProGP106

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP106
Validation Status Characterized
Organism Information
Organism NamePedobacter heparinus (Flavobacterium heparinum)
Domain Bacteria
Classification Family: Sphingobacteriaceae
Order: "Sphingobacteriales"
Class: "Sphingobacteria"
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 984
Genome Sequence(s)
GenBank CP001681.1
EMBL L12534
Organism Additional Information Pedobacter heparinus is a Gram-negative, nonpathogenic soil organism.
Gene Information
Gene Namehep A
NCBI Gene ID 8251559
GenBank Gene Sequence 8251559
Protein Information
Protein NameHeparin lyase I or Heparinase I
UniProtKB/SwissProt ID Q05819
NCBI RefSeq YP_003090758.1
EMBL-CDSAAA24920.1
UniProtKB Sequence >sp|Q05819|HEP1_PEDHE Heparin lyase I OS=Pedobacter heparinus PE=1 SV=1 MKKQILYLIVLQQLFLCSAYAQQKKSGNIPYRVNVQADSAKQKAIIDNKWVAVGINKPYA LQYDDKLRFNGKPSYRFELKAEDNSLEGYAAGETKGRTELSYSYATTNDFKKFPPSVYQN AQKLKTVYHYGKGICEQGSSRSYTFSVYIPSSFPDNATTIFAQWHGAPSRTLVATPEGEI KTLSIEEFLALYDRMIFKKNIAHDKVEKKDKDGKITYVAGKPNGWKVEQGGYPTLAFGFS KGYFYIKANSDRQWLTDKADRNNANPENSEVMKPYSSEYKTSTIAYKMPFAQFPKDCWIT FDVAIDWTKYGKEANTILKPGKLDVMMTYTKNKKPQKAHIVNQQEILIGRNDDDGYYFKF GIYRVGNSTVPVTYNLSGYSETAR
Sequence length 384 AA
Subcellular LocationPeriplasm
Function GAG lyase. EC= 4.2.2.7. It has been assigned to the polysaccharide lyase family PL13. Degrades heparin and heparan sulfate. Also implicated in the release of heparin-bound growth factors from the extracellular matrix.
Glycosylation Status
Glycosylation Type O (Ser) linked
Experimentally Validated Glycosite(s) in Full Length ProteinS39
Experimentally Validated Glycosite(s ) in Mature ProteinS39
Glycosite(s) Annotated Protein Sequence >sp|Q05819|HEP1_PEDHE Heparin lyase I OS=Pedobacter heparinus PE=1 SV=1 MKKQILYLIVLQQLFLCSAYAQQKKSGNIPYRVNVQADS*(39)AKQKAIIDNKWVAVGINKPYA LQYDDKLRFNGKPSYRFELKAEDNSLEGYAAGETKGRTELSYSYATTNDFKKFPPSVYQN AQKLKTVYHYGKGICEQGSSRSYTFSVYIPSSFPDNATTIFAQWHGAPSRTLVATPEGEI KTLSIEEFLALYDRMIFKKNIAHDKVEKKDKDGKITYVAGKPNGWKVEQGGYPTLAFGFS KGYFYIKANSDRQWLTDKADRNNANPENSEVMKPYSSEYKTSTIAYKMPFAQFPKDCWIT FDVAIDWTKYGKEANTILKPGKLDVMMTYTKNKKPQKAHIVNQQEILIGRNDDDGYYFKF GIYRVGNSTVPVTYNLSGYSETAR
Sequence Around Glycosites (21 AA) IPYRVNVQADSAKQKAIIDNK
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPresence of multiple isoforms in the RPHPLC (reverse-phase high pressure liquid chromatography) profile, and mass excess (approx. 1.1 kDa) detected using mass spectrometry.
Technique(s) used for Glycosylated Residue(s) Detection NMR and mass spectrometry
Glycan Information
Glycan Annotation Linkage: Man-Ser.
Branched heptasaccharide is: galactose-β(1–4)[galactose-α(1–3)](2-O-Me)fucose-β(1–4)xylose-β (1–4)glucuronic acid-α(1–2)[rhamnose-α(1–4)]mannose-α(1-O)Ser.
Technique(s) used for Glycan Identification Combination of enzymatic digestion, NMR and mass spectroscopy.
Literature
Additional CommentSequon features: Asp-Ser consensus sequon is found in this protein.
Post translational modification was detected as early as 1993 but the glycosylation was confirmed in 1995.
Year of Identification1995
Year of Identification Month Wise1995.05
Year of Validation 1995
Reference1) Shaya, D., Tocilj, A., Li, Y., Myette, J., Venkataraman, G., Sasisekharan, R. and Cygler, M. (2006) Crystal structure of heparinase II from Pedobacter heparinus and its complex with a disaccharide product. J Biol Chem, 281, 15525-15535. [PubMed: 16565082]
AuthorShaya, D., Tocilj, A., Li, Y., Myette, J., Venkataraman, G., Sasisekharan, R. and Cygler, M.
Research GroupDepartment of Biochemistry, McGill University, Montreal, Quebec H3G 1Y6, Canada.
Corresponding Author Cygler, M.
ContactDepartment of Biochemistry, McGill University, Montreal, Quebec H3G 1Y6, Canada.
Reference Godavarti, R. and Sasisekharan, R. (1996) A comparative analysis of the primary sequences and characteristics of heparinases I, II, and III from Flavobacterium heparinum. Biochem Biophys Res Commun, 229, 770-777. [PubMed: 8954971]
Author Godavarti, R. Sasisekharan, R.
Research GroupDepartment of Chemical Engineering, Massachusetts Institute of Technology, Cambridge, Massachusetts, 02139, USA.
Corresponding Author Sasisekharan, R.
ContactDepartment of Chemical Engineering, Massachusetts Institute of Technology, Cambridge, Massachusetts, 02139, USA.
Reference Godavarti, R. and Sasisekharan, R. (1996) A comparative analysis of the primary sequences and characteristics of heparinases I, II, and III from Flavobacterium heparinum. Biochem Biophys Res Commun, 229, 770-777. [PubMed: 8954971]
Author Godavarti, R. Sasisekharan, R.
Research GroupDepartment of Chemical Engineering, Massachusetts Institute of Technology, Cambridge, Massachusetts, 02139, USA.
Corresponding Author Sasisekharan, R.
ContactDepartment of Chemical Engineering, Massachusetts Institute of Technology, Cambridge, Massachusetts, 02139, USA.
Reference Sasisekharan, R., Bulmer, M., Moremen, K.W., Cooney, C.L. and Langer, R. (1993) Cloning and expression of heparinase I gene from Flavobacterium heparinum. Proc Natl Acad Sci U S A, 90, 3660-3664. [PubMed: 8475114]
Author Sasisekharan, R., Bulmer, M., Moremen, K.W., Cooney, C.L. Langer, R.
Research GroupBuilding, King’s Buildings, University of Edinburgh,
Corresponding Author Langer, R.
ContactBuilding, King’s Buildings, University of Edinburgh,
Reference Huang L., van Halbeek H., Eggimann B., Zimmermannn J. (1995) Structural characterization of the novel O-linked carbohydrate structure of Flavobacterium heparinum heparinase I. Glycobiology 5, 712-712.
Corresponding Author