ProGP109

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP109
Validation Status Uncharacterized
Organism Information
Organism NameStaphylothermus marinus F1
Domain Archaea
Classification Family: Desulfurococcaceae
Order: Desulfurococcales
Class: Thermoprotei or Crenarchaeota
Division or phylum: "Crenarchaeota"
Taxonomic ID (NCBI) 2280
Genome Sequence(s)
EMBL U57968
Protein Information
Protein NameStable protease
UniProtKB/SwissProt ID Q54437
EMBL-CDSAAB02323.1
UniProtKB Sequence >tr|Q54437|Q54437_STAMA STABLE protease OS=Staphylothermus marinus PE=4 SV=1 MRRLLVILSLIIIVGLIMPSLSLSAPVTVGNKDLNKFTIDPNWQNKIPKKLFDDVYTNAK IKKAAFMPYGIQTVKKIMLFDSNSRTLLLIGDNSENTVRYIIQNTEKLLYKFPLLGNHVI YYVVATPDQVVKLAKYPGIYRITPSPPITKLIKLNNMIKKAEGAGSSFEIKTADNNENAT IDTNMGVKLIGATEVWREYNITGEGIVVGIVDTGIDLSNPDLGLDVIARDDNGTPLLLAY DNGLTLVTGKAVAYNGTLNTTGLTVLAFDPLYTLVYGIPVLIEAQFNYNITVGNITSQSG IYRVGLAPYLFSDTLTGYYIRTFVPVVLVDSETPGVYDEAYFDLSTAFYDLSEYMRYLEN VTLGHIYWRAPDPAWNDTSITDETPFGPGNEIVGRDFDGDGIIDFSIGTIAGYYLDSYGL ATLTYDPTTGNITLGTPGLYPGWDYQGRYLALVSDFHGHGTSVATVIASRGRVLYDLYGD GKLYRIMGVAPGAKIAGGDAWLLGNILVLEAWLAGFNIVTEEEDGYVYLSLDPFGPHRAD IISNSWGSIYINFWLQQFPGIDYRSSFMDEILAIRNYLIGDHVTIVFAAGNEGPGYSSNG APGTGLLVITAGASTLWDYTRIYGYPEGYADEVIPFSSRGPTGQGYPKPDIVNIGAFEWA STRTIDGRGYGAQPDVFGGTSEATPYTSGTLALVFQAYKEVYNTTPDPVTAKIILKSSAK DIWYPAFSQGSGRVDALKAADTVFISEWLAYVSEGIQEAFLENYYTDFGPYIGYVLPYLA DTDYYGVVKPGSSKNFTLNIVGNGAVSLSAWNTVLYKEYTVYDGVYDYSGLLFLKVPKYA YSGADYVEVVVQLENMTYPPGVFLKTPIDPLHAIILSAYDWIDYNGDGQIGYPDELHYIT FEYRVSTEAVVSISAPMEKIHGDLVLRIRPDYINVTPVKMKIVVRSFKYVPCKLMSLPNT VDVNGTASIPITINVPDNFRPGILEVRLIVDTPDKRIVVPVSILVPLIADETTTAVLGGA RSPMKYDPFAMYGLPDPVYGVWEGQDWRILPVLVTDPSITGLIVVARWASGYASDLSFLT VAPGGVFTPNGFLNVFASYKLSYDLGLVYNPSLSDQLHGKLRMYIPVKWAEPLRQIPIAI TDLSYWPPEPGLALMQYSDRMPEIYGLYRIIYGFASYSGKLLEDKLMFRIITVKSEIQYS EQFSFNNISVGNLYVKFTAGSYTPFLFADLYLYTEGYATPLAGSGSILPISILVNGTASN LAYYLVLYDYAYYLGTSPTGLYSEFTVPVMINTSATNVFNAIAVMYKYSWHAEGMYWFDF NTGEPLIISYVHPGMASATLNISNT
Sequence length 1345 AA (24 AA signal peptide)
Subcellular LocationSurface
Function Possesses peptidylglutamylhydrolyzing activity. It has both tryptic and chymotryptic activity, and is one of the most stable (thermostable) proteases.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionCarbohydrate analysis using trifluoroacetic acid and GC/MS.
Glycan Information
Glycan Annotation Carbohydrates (glucose, mannose, and glucosamine). Both N and O linked glycans present.
Literature
Year of Identification1995
Year of Identification Month Wise1995.01
Reference1) Peters, J., Nitsch, M., Kuhlmorgen, B., Golbik, R., Lupas, A., Kellermann, J., Engelhardt, H., Pfander, J.P., Muller, S., Goldie, K. et al. (1995) Tetrabrachion: a filamentous archaebacterial surface protein assembly of unusual structure and extreme stability. J Mol Biol, 245, 385-401. [PubMed: 7837271]
AuthorPeters, J., Nitsch, M., Kuhlmorgen, B., Golbik, R., Lupas, A., Kellermann, J., Engelhardt, H., Pfander, J.P., Muller, S., Goldie, K
Research GroupMax-Planck-Institut für Biochemie, Martinsried, Germany.
Corresponding Author Goldie, K
ContactMax-Planck-Institut für Biochemie, Martinsried, Germany.