ProGP110

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP110
Validation Status Uncharacterized
Organism Information
Organism NameMycobacterium bovis BCG
Domain Bacteria
Classification Family: Mycobacteriaceae
Suborder: Corynebacterineae
Order: Actinomycetales
Subclass: Actinobacteridae
Class: Actinobacteria
Division or phylum: "Actinobacteria"
Taxonomic ID (NCBI) 410289
Genome Sequence(s)
GenBank AM408590.1
EMBL AM408590
Organism Additional Information Mycobacterium bovis is the etiologic agent of bovine tuberculosis.
Gene Information
Gene Nameapa (BCG_1896)
NCBI Gene ID 4695569
Protein Information
Protein Name45- to 47-kDa protein
UniProtKB/SwissProt ID P80069
NCBI RefSeq YP_977986.1
EMBL-CDSCAL71883.1
UniProtKB Sequence >sp|P80069|APA_MYCBP Alanine and proline-rich secreted protein apa OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=apa PE=1 SV=2 MHQVDPNLTRRKGRLAALAIAAMASASLVTVAVPATANADPEPAPPVPTTAASPPSTAAA PPAPATPVAPPPPAAANTPNAQPGDPNAAPPPADPNAPPPPVIAPNAPQPVRIDNPVGGF SFALPAGWVESDAAHLDYGSALLSKTTGDPPFPGQPPPVANDTRIVLGRLDQKLYASAEA TDSKAAARLGSDMGEFYMPYPGTRINQETVSLDANGVSGSASYYEVKFSDPSKPNGQIWT GVIGSPAANAPDAGPPQRWFVVWLGTANNPVDKGAAKALAESIRPLVAPPPAPAPAPAEP APAPAPAGEVAPTPTTPTPQRTLPA
Sequence length 325 AA
Subcellular LocationSecreted
Function Dominant immunogen
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionConcanavalin A-binding, biotin-hydrazide labeling, partial deglycosylation with jack bean α-D-mannosidase
Glycan Information
Glycan Annotation Presence of α-D-mannosyl linkage.
Literature
Year of Identification1995
Year of Identification Month Wise1995.02
Reference1) Espitia, C., Espinosa, R., Saavedra, R., Mancilla, R., Romain, F., Laqueyrerie, A. and Moreno, C. (1995) Antigenic and structural similarities between Mycobacterium tuberculosis 50- to 55-kilodalton and Mycobacterium bovis BCG 45- to 47-kilodalton antigens. Infect Immun, 63, 580-584. [PubMed: 7822025]
Author Moreno, C.
Research GroupTuberculosis and Related Infections Unit, Royal Postgraduate Medical School, Hammersmith Hospital, London, United Kingdom.
Corresponding Author Espitia, C., Espinosa, R., Saavedra, R., Mancilla, R., Romain, F., Laqueyrerie, A. Moreno, C.
ContactTuberculosis and Related Infections Unit, Royal Postgraduate Medical School, Hammersmith Hospital, London, United Kingdom.