ProGP113

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP113
Validation Status Uncharacterized
Organism Information
Organism NameAzospirillum brasilense Sp7
Domain Bacteria
Classification Family: Rhodospirillaceae
Order: Rhodospirillales
Class: Alphaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 192
Genome Sequence(s)
GenBank U26679
EMBL U26679
Gene Information
Gene Namelaf1
Protein Information
Protein NameFlagellin Laf1
UniProtKB/SwissProt ID Q43896
EMBL-CDSAAA86521.1
UniProtKB Sequence >tr|Q43896|Q43896_AZOBR Flagellin Laf1 OS=Azospirillum brasilense GN=laf1 PE=4 SV=1 MASIMTNTSAMTALQTVRRVTDDLATTQDRISTGLKVNNAKDNAAYWSIATTMRADVAGF KAVKESLELGSGTTNTASVASKNIVENLQTLKARVIAGQTNGVDKSLIQNDIDQLVKLVK GAAADASFNGDNLLRITYSNDGTAKDQNVDILASLSRSAGTVDPSYISFQRQDMQVTSIV GKATIEQQVDSTNDLKASVGIAIGAPDTTFIDGQNLGLGNLTLNVTNEAGTKTAVTVDLS GIDYTTDLATTQGLIETAVNAALTTAGGDFQVAFNGDKLEFTDQDLNTDGNFTAKVDSLW VGSKESDAFGGLADLTQIDVTSNATKSLEVINGLLDKAIGKAAVIGSIENRVSVQNDFVS KLTDSMNKGIGSLVDADMNEESSRLQALQVQQQLATQALSIANQGPQNILSLFR
Sequence length 414 AA
Subcellular LocationFlagellum
Function Flagellin is the subunit protein which polymerizes to form the filaments of flagella.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPAS-staining, chemical (TFMS) deglycosylation, DIG glycan detection, and sugar-specific monoclonal antibody in immunogold labelling coupled with TEM.
Literature
Year of Identification1995
Year of Identification Month Wise1995.06
ReferenceMoens, S., Michiels, K. and Vanderleyden, J. (1995) Glycosylation of the flagellin of the polar flagellum of Azospirillum brasilense, a Gram-negative nitrogen-fixing bacterium. Microbiology, 141, 2651-2657
AuthorMoens, S., Michiels, K. and Vanderleyden, J.
Research GroupCatholic University of Leuven, Kardinaal Mercierlaan 92, B-3001 Heverlee, Belgium
Corresponding Author Vanderleyden, J.
ContactCatholic University of Leuven, Kardinaal Mercierlaan 92, B-3001 Heverlee, Belgium