ProGP114 (Endo-β-N-acetylglucosaminidase F2)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP114 (Endo-β-N-acetylglucosaminidase F2)
Validation Status Characterized
Organism Information
Organism NameFlavobacterium meningosepticum (Elizabethkingia meningoseptica)
Domain Bacteria
Classification Family: Flavobacteriaceae
Order: "Flavobacteriales"
Class: Flavobacteria
Division or phylum: "Bacteroidetes"
Taxonomic ID (NCBI) 238
Genome Information
GenBank L06331
EMBL L06331
Gene Information
Gene NameendO F2
Protein Information
Protein NameEndo-β-N-acetylglucosaminidase F2
UniProtKB/SwissProt ID P36912
EMBL-CDSAAA24923.1
UniProtKB Sequence >sp|P36912|EBA2_FLAME Endo-beta-N-acetylglucosaminidase F2 OS=Flavobacterium meningosepticum GN=endOF2 PE=1 SV=1 MKTANFSFALCLSVVIMLFIKCTRSEQDLSVTKDAIAQKSGVTVSAVNLSNLIAYKNSDH QISAGYYRTWRDSATASGNLPSMRWLPDSLDMVMVFPDYTPPENAYWNTLKTNYVPYLHK RGTKVIITLGDLNSATTTGGQDSIGYSSWAKGIYDKWVGEYNLDGIDIDIESSPSGATLT KFVAATKALSKYFGPKSGTGKTFVYDTNQNPTNFFIQTAPRYNYVFLQAYGRSTTNLTTV SGLYAPYISMKQFLPGFSFYEENGYPGNYWNDVRYPQNGTGRAYDYARWQPATGKKGGVF SYAIERDAPLTSSNDNTLRAPNFRVTKDLIKIMNP
Sequence length 335 AA
Subcellular LocationPeriplasm (secreted)
Function Endohydrolysis of the di-N-acetylchitobiosyl unit in high-mannose glycopeptides and glycoproteins. Complex biantennary glycans are the preferred substrates. EC= 3.2.1.96.
Glycosylation Status
Glycosylation Type O- (Ser) linked
Experimentally Validated Glycosite(s) in Full Length Protein(Signal peptide: 1-45) S73, S89, S143
Experimentally Validated Glycosite(s ) in Mature ProteinS28, S44, S98
Glycosite(s) Annotated Protein Sequence >sp|P36912|EBA2_FLAME Endo-beta-N-acetylglucosaminidase F2 OS=Flavobacterium meningosepticum GN=endOF2 PE=1 SV=1 MKTANFSFALCLSVVIMLFIKCTRSEQDLSVTKDAIAQKSGVTVSAVNLSNLIAYKNSDH QISAGYYRTWRDS*(73)ATASGNLPSMRWLPDS*(89)LDMVMVFPDTPPENAYWNTLKTNYVPYLHK RGTKVIITLGDLNSATTTGGQDS*(143)IGYSSWAKGIYDKWVGEYNLDGIDIDIESSPSGATLT KFVAATKALSKYFGPKSGTGKTFVYDTNQNPTNFFIQTAPRYNYVFLQAYGRSTTNLTTV SGLYAPYISMKQFLPGFSFYEENGYPGNYWNDVRYPQNGTGRAYDYARWQPATGKKGGVF SYAIERDAPLTSSNDNTLRAPNFRVTKDLIKIMNP
Sequence Around Glycosites (21 AA) SAGYYRTWRDSATASGNLPSM
NLPSMRWLPDSLDMVMVFPDY
NSATTTGGQDSIGYSSWAKGI
ProGP Web Logo
Technique(s) used for Glycosylation DetectionMass shift detected on SDS-polyacrylamide gel and phenol-sulfuric acid assay
Technique(s) used for Glycosylated Residue(s) Detection Edman degradation and collision activated dissociation (CAD) mass spectrometry
Protein Glycosylation- Implication Glycosylation may contribute towards protein stability
Glycan Information
Glycan Annotation Linkage: Man- Ser.
Branched acidic, heptasaccharide (1244 Da) containing 3 different uronyl analogs (uronic acid derivatives), a methylated Rham and Man, a Glc, and a reducing terminal Man. Only pyranose ring forms were detected [(2-OMe)Man1-4GlcNAcU1-4GlcU1-4Glc1-4(2-OMe)GlcU-4[(2-OMe)Rham1-2]Man].
BCSDB ID137520
Technique(s) used for Glycan Identification ESI-MS (electrospray ionization mass spectrometry), CID (collision-induced dissociation), and a combination of isotopic labeling, composition and methylation analysis.
Literature
Year of Identification1995
Year of Identification Month Wise1995.06.02
Year of Validation 1995