ProGP117 (Cell surface glycoprotein (S-layer prote

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP117 (Cell surface glycoprotein (S-layer prote
Validation Status Uncharacterized
Organism Information
Organism NameHaloarcula japonica strain TR-1
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 29282
Genome Information
GenBank D87290
EMBL D87290
Gene Information
Gene Namecsg
Protein Information
Protein NameCell surface glycoprotein (S-layer protein)
UniProtKB/SwissProt ID Q9C4B4
EMBL-CDSBAB39352.1.
UniProtKB Sequence >sp|Q9C4B4|CSG_HALJP Cell surface glycoprotein OS=Haloarcula japonica GN=csg PE=1 SV=1 MTDTQQKIKAVLLTVLMVTSVFAATIAFSGAAAASERGAGDSYTTGPTDGNQDNVDSAGN VGAGAVVFQGEDDIEGEFADGNGDTVGIGELQKVSGDNEGILLESPIPQDQPTGRYTANP GVEGTEGVTLQTPRITDLEIQNSDEGDVTGSILQANNDNTAEILVDYNYDEAEDLELTVE DEDGLEVTEEILADGASETVNTNVNNDDHPNPAADGDRDDSFDAGFTINPSNVDEGEYTI TVEGVEDLDFGDASETATVEITTDQTASLSLDSDEVTQGEDLGFDIENSPEGNFHAVVIE ESEFRDSASASNYAKVFRNVGDTSDRGLVGEDADGNTVAVAPGDADSLESIDYAYGIVEI DGGTGVGSAETQYLDDSSIDIDLYEAANGDYTDNNAHVNDINLVTDDTYETDDEQDFDVL EGDLTIDSPSGTYVTGSEVDVNGTASEGIDDVAIYARDNNDYELVEIDSEETISVDGDDT FSEEDISLSGGDLGGNDILGLPGTYRIGVVDVEDADSNSNGTVDDSLTTSEFNSGVSSAE SLRVTDTELNGTFITYNGQISSDDNQIDVEGQAPGKDNLVIAFVDSRGNAVATDISVDDD DTFSEDDISISALSEGTVTAHIISSGRDNLFGDGVSDSSSGFASLIEEEYASGSSTGDQV RSRILENSVDDTASDDLIVNEQFRLADGLTIVESVNSPVEANGTIEIEGTTNRKPDDNTI TVELLDDEDESVTVDSTDEWSSDGQWSVSLDLSDENVEPGNFTVEADDGDNTDRQSVQIV EAGSLEEEQPATDTPEPDTDTPEPATDTPEPATDTPEPDTDTPEPDTETEEATTEATGPG FTAAIALIALVAAALLAVRRDN
Sequence length 862 AA (signal peptide 34 AA)
Subcellular LocationSurface
Function It is the component of the S-layer. The S-layer is a paracrystalline mono-layered assembly of proteins which coat the surface of the cell.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPAS staining and phenol-sulfuric acid method
Glycan Information
Glycan Annotation Contains N-linked glycans.
Literature
Year of Identification1995
Year of Identification Month Wise1995.07