ProGP117

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP117
Validation Status Uncharacterized
Organism Information
Organism NameHaloarcula japonica strain TR-1
Domain Archaea
Classification Family: Halobacteriaceae
Order: Halobacteriales
Class: Halobacteria or Halomebacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 29282
Genome Sequence(s)
GenBank D87290
EMBL D87290
Gene Information
Gene Namecsg
Protein Information
Protein NameCell surface glycoprotein (S-layer protein)
UniProtKB/SwissProt ID Q9C4B4
EMBL-CDSBAB39352.1.
UniProtKB Sequence >sp|Q9C4B4|CSG_HALJP Cell surface glycoprotein OS=Haloarcula japonica GN=csg PE=1 SV=1 MTDTQQKIKAVLLTVLMVTSVFAATIAFSGAAAASERGAGDSYTTGPTDGNQDNVDSAGN VGAGAVVFQGEDDIEGEFADGNGDTVGIGELQKVSGDNEGILLESPIPQDQPTGRYTANP GVEGTEGVTLQTPRITDLEIQNSDEGDVTGSILQANNDNTAEILVDYNYDEAEDLELTVE DEDGLEVTEEILADGASETVNTNVNNDDHPNPAADGDRDDSFDAGFTINPSNVDEGEYTI TVEGVEDLDFGDASETATVEITTDQTASLSLDSDEVTQGEDLGFDIENSPEGNFHAVVIE ESEFRDSASASNYAKVFRNVGDTSDRGLVGEDADGNTVAVAPGDADSLESIDYAYGIVEI DGGTGVGSAETQYLDDSSIDIDLYEAANGDYTDNNAHVNDINLVTDDTYETDDEQDFDVL EGDLTIDSPSGTYVTGSEVDVNGTASEGIDDVAIYARDNNDYELVEIDSEETISVDGDDT FSEEDISLSGGDLGGNDILGLPGTYRIGVVDVEDADSNSNGTVDDSLTTSEFNSGVSSAE SLRVTDTELNGTFITYNGQISSDDNQIDVEGQAPGKDNLVIAFVDSRGNAVATDISVDDD DTFSEDDISISALSEGTVTAHIISSGRDNLFGDGVSDSSSGFASLIEEEYASGSSTGDQV RSRILENSVDDTASDDLIVNEQFRLADGLTIVESVNSPVEANGTIEIEGTTNRKPDDNTI TVELLDDEDESVTVDSTDEWSSDGQWSVSLDLSDENVEPGNFTVEADDGDNTDRQSVQIV EAGSLEEEQPATDTPEPDTDTPEPATDTPEPATDTPEPDTDTPEPDTETEEATTEATGPG FTAAIALIALVAAALLAVRRDN
Sequence length 862 AA (signal peptide 34 AA)
Subcellular LocationSurface
Function It is the component of the S-layer. The S-layer is a paracrystalline mono-layered assembly of proteins which coat the surface of the cell.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPAS staining and phenol-sulfuric acid method
Glycan Information
Glycan Annotation Contains N-linked glycans.
Literature
Year of Identification1995
Year of Identification Month Wise1995.07
ReferenceWakai, H., Nakamura, S., Kawasaki, H., Takada, K., Mizutani, S., Aono, R. and Horikoshi, K. (1997) Cloning and sequencing of the gene encoding the cell surface glycoprotein of Haloarcula japonica strain TR-1. Extremophiles, 1, 29-35. [PubMed: 9680334]
Author Wakai, H., Nakamura, S., Kawasaki, H., Takada, K., Mizutani, S., Aono, R. Horikoshi, K.
Research GroupDepartment of Bioengineering, Tokyo Institute of Technology, Kanagawa, Japan.
Corresponding Author Horikoshi, K.
ContactDepartment of Bioengineering, Tokyo Institute of Technology, Kanagawa, Japan.
ReferenceNakamura, S., Mizutani, S., Wakai, H., Kawasaki, H., Aono, R. and Horikoshi, K. (1995) Purification and partial characterization of cell surface glycoprotein from extremely halophilic archaeon Haloarcula japonica strain TR-1. Biotechnol Lett, 17, 705-70.
AuthorNakamura, S., Mizutani, S., Wakai, H., Kawasaki, H., Aono, R. Horikoshi, K.
Research GroupDepartment of Bioengineering, Faculty of Bioscience and Biotechnology, Tokyo Institute of TechnologyYokohamaJapan
Corresponding Author Horikoshi, K.
ContactDepartment of Bioengineering, Faculty of Bioscience and Biotechnology, Tokyo Institute of TechnologyYokohamaJapan