ProGP121

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP121
Validation Status Characterized
Organism Information
Organism NameAneurinibacillus thermoaerophilus DSM 10155
Domain Bacteria
Classification Family: Paenibacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 143495
Genome Sequence(s)
EMBL AY395579
Gene Information
Gene Namesat B
Protein Information
Protein NameSurface-layer glycoprotein Sat B
UniProtKB/SwissProt ID Q6TL21
EMBL-CDSAAS44592.1
UniProtKB Sequence >tr|Q6TL21|Q6TL21_ANETH Surface-layer glycoprotein SatB OS=Aneurinibacillus thermoaerophilus GN=satB PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANITNLVNKVLNVKSNYDGEQSASHTLTVKE DDIAFDQTSGETFRVVLPSGVKWKTAPANTPTAKFDLRSDQVLEVTVKGTNTIADDEQVS IPLNFKVDGATGELKLKVESMDSTITSGEYVFAIVGSGSTTAAVDNVKNIGKSGKAGTIR VEETAIGAVADGRNHKVKLKLPSNFRWVTTGTDKTEISTSGGFTSASIVTGESNDNVLVL DVATATGQGRGVLYVTPYIKADKDASYGDVSVNIRGPDFSDSDVVVAKYGDWGATIKVEK VEEVLAGKYDENTRTAKITIEESVPGSFVKGRDIDVELPSWVKVTDIKEFTTSGFTTGAP TSGSVDIDGTDNKISIPLGETGGSSTAKIEFKLELSVQADKTGDIEAVISGGGVAEQKAV IAKAVAPVSVALDGEASKVKIGAQAQDAPNIIITELKKGAIEKTTENGSTTNGTIEVKLP DGVKFASVPKVEVVEGDGTIDVDNVRRINNDNVLTIPVKGESVSKPMKIKLSNVKLTVDR TVPEGDIELKVGGNAIVENYKSGKGWLKGNKQNGSSDALDAGEFNTEHAAKVVVAKTVTP APTDTTATNIVFKLNSKTYTVDGKEFEMDAAPLVGWDRAYLPVRFAANALNVSDDQIVWD DKTSTFTIFKGDRVISGKVGDKFLTVNGAKVPMDVPVWRNKEKTNNRVMVPIRYLANALN AEIEWNKETSEITIQAKK
Sequence length 738 AA
Subcellular LocationSurface
Glycosylation Status
Glycosylation Type O (Ser/Thr) linked
Experimentally Validated Glycosite(s) in Full Length ProteinT471 and /or S69
Experimentally Validated Glycosite(s ) in Mature ProteinT471 and /or S69
Glycosite(s) Annotated Protein Sequence >tr|Q6TL21|Q6TL21_ANETH Surface-layer glycoprotein SatB OS=Aneurinibacillus thermoaerophilus GN=satB PE=3 SV=1 MKTNKALKVLTTSALLASVAAPFGAGVVSANITNLVNKVLNVKSNYDGEQSASHTLTVKE DDIAFDQTS*(69)GETFRVVLPSGVKWKTAPANTPTAKFDLRSDQVLEVTVKGTNTIADDEQVS IPLNFKVDGATGELKLKVESMDSTITSGEYVFAIVGSGSTTAAVDNVKNIGKSGKAGTIR VEETAIGAVADGRNHKVKLKLPSNFRWVTTGTDKTEISTSGGFTSASIVTGESNDNVLVL DVATATGQGRGVLYVTPYIKADKDASYGDVSVNIRGPDFSDSDVVVAKYGDWGATIKVEK VEEVLAGKYDENTRTAKITIEESVPGSFVKGRDIDVELPSWVKVTDIKEFTTSGFTTGAP TSGSVDIDGTDNKISIPLGETGGSSTAKIEFKLELSVQADKTGDIEAVISGGGVAEQKAV IAKAVAPVSVALDGEASKVKIGAQAQDAPNIIITELKKGAIEKTTENGSTT*(471)NGTIEVKLP DGVKFASVPKVEVVEGDGTIDVDNVRRINNDNVLTIPVKGESVSKPMKIKLSNVKLTVDR TVPEGDIELKVGGNAIVENYKSGKGWLKGNKQNGSSDALDAGEFNTEHAAKVVVAKTVTP APTDTTATNIVFKLNSKTYTVDGKEFEMDAAPLVGWDRAYLPVRFAANALNVSDDQIVWD DKTSTFTIFKGDRVISGKVGDKFLTVNGAKVPMDVPVWRNKEKTNNRVMVPIRYLANALN AEIEWNKETSEITIQAKK
Sequence Around Glycosites (21 AA) IEKTTENGSTTNGTIEVKLPD
KEDDIAFDQTSGETFRVVLPS
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS) staining
Technique(s) used for Glycosylated Residue(s) Detection Modified Edman degradation
Glycan Information
Glycan Annotation Linkage: β-GalNAc-Ser/Thr.
Total carbohydrate content of 15%.
Disaccharide repeating unit composed of L-rhamnose and D-glycero-D-manno-heptose residues: →4)-α-L-Rhap-(1→3)-β-D-glycero-D-manno-Hepp-(1→ and β-D-GalpNAc-(1→O)-Ser/Thr linkage. Equal amounts of the complete core structure α-L-Rhap-(1→3)-α-L-Rhap-(1→3)-β-D-GalpNAc-(1→O)-Ser/Thr and the truncated forms α-L-Rhap-(1→3)-β-D-GalpNAc-(1→O)-Ser/Thr and β-D-GalpNAc-(1→O)-Ser/Thr are present. The different cores were substituted with varying numbers of disaccharide repeating units.
BCSDB ID23143, 943
Literature
Year of Identification1995
Year of Identification Month Wise1995.12.25
Year of Validation 1999
Reference Wugeditsch, T., Zachara, N.E., Puchberger, M., Kosma, P., Gooley, A.A. and Messner, P. (1999) Structural heterogeneity in the core oligosaccharide of the S-layer glycoprotein from Aneurinibacillus thermoaerophilus DSM 10155. Glycobiology, 9, 787-795.[PubMed: 10406844]
Author Messner, P.
Research GroupZentrum für Ultrastrukturforschung und Ludwig Boltzmann-Institut für Molekulare Nanotechnologie, Universität für Bodenkultur, A-1180 Wien, Austria.
Corresponding Author Wugeditsch, T., Zachara, N.E., Puchberger, M., Kosma, P., Gooley, A.A. Messner, P.
ContactZentrum für Ultrastrukturforschung und Ludwig Boltzmann-Institut für Molekulare Nanotechnologie, Universität für Bodenkultur, A-1180 Wien, Austria.
Reference Kneidinger, B., Graninger, M., Puchberger, M., Kosma, P. and Messner, P. (2001) Biosynthesis of nucleotide-activated D-glycero-D-manno-heptose. J Biol Chem, 276, 20935-20944. [PubMed: 11279237]
Author Kneidinger, B., Graninger, M., Puchberger, M., Kosma, P. Messner, P.
Research GroupZentrum für Ultrastrukturforschung und Ludwig Boltzmann-Institut für Molekulare Nanotechnologie, Universität für Bodenkultur Wien, Gregor-Mendel-Strasse 33, A-1180 Wien, Austria.
Corresponding Author Messner, P.
ContactZentrum für Ultrastrukturforschung und Ludwig Boltzmann-Institut für Molekulare Nanotechnologie, Universität für Bodenkultur Wien, Gregor-Mendel-Strasse 33, A-1180 Wien, Austria.
Reference Kneidinger, B., Graninger, M., Puchberger, M., Kosma, P. and Messner, P. (2001) Biosynthesis of nucleotide-activated D-glycero-D-manno-heptose. J Biol Chem, 276, 20935-20944. [PubMed: 11279237]
Author Kneidinger, B., Graninger, M., Puchberger, M., Kosma, P. and Messner, P.
Research GroupZentrum für Ultrastrukturforschung und Ludwig Boltzmann-Institut für Molekulare Nanotechnologie, Universität für Bodenkultur Wien, Gregor-Mendel-Strasse 33, A-1180 Wien, Austria.
Corresponding Author Messner, P.
ContactZentrum für Ultrastrukturforschung und Ludwig Boltzmann-Institut für Molekulare Nanotechnologie, Universität für Bodenkultur Wien, Gregor-Mendel-Strasse 33, A-1180 Wien, Austria.
Reference1) Messner, P., Steiner, K., Zarschler, K. and Schaffer, C. (2008) S-layer nanoglycobiology of bacteria. Carbohydr Res, 343, 1934-1951. [PubMed: 18336801]
Author Messner, P., Steiner, K., Zarschler, K. and Schaffer, C
Research GroupUniversität für Bodenkultur Wien, Zentrum für NanoBiotechnologie A-1180 Wien, Gregor-Mendel-Strasse 33, Austria. paul.messner@boku.ac.at
Corresponding Author Schaffer, C.
ContactUniversität für Bodenkultur Wien, Zentrum für NanoBiotechnologie A-1180 Wien, Gregor-Mendel-Strasse 33, Austria. paul.messner@boku.ac.at
Reference Kosma, P., Wugeditsch, T., Christian, R., Zayni, S. and Messner, P. (1995) Glycan structure of a heptose-containing S-layer glycoprotein of Bacillus thermoaerophilus. Glycobiology, 5, 791-796. [PubMed: 8720077]
Author Kosma, P., Wugeditsch, T., Christian, R., Zayni, S. Messner, P.
Research GroupInstitut für Chemie, Universität für Bodenkultur, Wien, Austria
Corresponding Author Messner, P.
ContactInstitut für Chemie, Universität für Bodenkultur, Wien, Austria