ProGP123

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP123
Validation Status Uncharacterized
Organism Information
Organism NameMethanobacterium bryantii BKYH
Domain Archaea
Classification Family: Methanobacteriaceae
Order: Methanobacteriales
Class: Methanobacteria or Archaeobacteria
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 2161
Genome Sequence(s)
GenBank U40213
EMBL U40213
Gene Information
Gene Namecrx
Protein Information
Protein NameCRX (Copper response extracellular protein)
UniProtKB/SwissProt ID Q48929
EMBL-CDSAAA97868.1
UniProtKB Sequence >tr|Q48929|Q48929_METBR Copper response extracellular protein OS=Methanobacterium bryantii PE=4 SV=1 MVNIDKKIVIIVGIVILIAVVAGAFLVTGTASADNKVRVGYLPSTGDSLYFIAKEKGYFA DEGLDVQLNEFQTGPDEINSLLADKLDVEAGGVGEPLNFINNGKDLEIIGGAMGGGSSVI AKDNQTAQALRDKPKNYEGKTVATVKMSTPDVTIKAALKEQGVDLNKVNFVEFKTAADVV QAVKSGKAQVGLVWPPFEYTAQQQGLIIVKYSDEYQPNHPCCRIVTTETKLKANPDKWVK FERALIRAYDFYKNNPDETTAIVGKYVKMDQTTLKKALYNGHLSLVPDPNKKGTLAYWNF LEQLGYSNITNTSALDKSIDTTVYKTALDQLAQQNPNNANYKFLEKQYIKLDQ
Sequence length 353 AA
Subcellular LocationSecreted
Function The CRX proteins are secreted at higher levels by this methanogen in response to copper exposure. Likely to be involved in copper resistance, although they could be synthesized as part of a more generic stress response. N-terminal leader peptide, containing 28 AA, that is removed during extracellular secretion.
Glycosylation Status
Technique(s) used for Glycosylation DetectionConA binding and deglycosylation with neuraminidase.
Literature
Year of Identification1995
Year of Identification Month Wise1995.12
ReferenceKim, B.K., Pihl, T.D., Reeve, J.N. and Daniels, L. (1995) Purification of the copper response extracellular proteins secreted by the copper-resistant methanogen Methanobacterium bryantii BKYH and cloning, sequencing, and transcription of the gene encoding these proteins. J Bacteriol, 177, 7178-7185. [PubMed: 8522526]
Author Daniels, L.
Research GroupDepartment of Microbiology, University of Iowa, Iowa City 52242, USA.
Corresponding Author Kim, B.K., Pihl, T.D., Reeve, J.N. Daniels, L.
ContactDepartment of Microbiology, University of Iowa, Iowa City 52242, USA.