ProGP124 (β-1,4-mannanase)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP124 (β-1,4-mannanase)
Validation Status Uncharacterized
Organism Information
Organism NameVibrio sp. strain MA-138
Domain Bacteria
Classification Family: Vibrionaceae
Order: "Vibrionales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 269094
Genome Information
GenBank D86329
EMBL D86329
Gene Information
Gene NamemanA
Protein Information
Protein Nameβ-1,4-mannanase
UniProtKB/SwissProt ID O69347
EMBL-CDSBAA25188.1
UniProtKB Sequence >tr|O69347|O69347_VIBSM Beta-1,4-mannanase OS=Vibrio sp. (strain MA-138) GN=manA PE=4 SV=1 MKFTKAIFSLLLFIWASCAHAGFYVSNGVLYEANGSAFKIRGINHAHTWYTDKLSVALSG IAATGANTVRVVLSNGYRWTKNDVSDVTNIINLAKANNLIAILEVHDTTGYGEESSAASL DSAADYWIELKNELIGQEDYVIINLGNEPFGNNNDAVAWVNDHVSAIQRLRSAGINHTIM VDAPNWGQDWKGFMLNNAQFVFNSDPKLNTIFSVHMYEVYSSYNSVNDYISSFTNNGLVL VIGEFASTHKGADVDEGSIMERSETLSLGYIGWSWSGNDTTTSDLDIVNNWDNNSYSTWG NVLINGQNGIKSTSTLATVFTCGNDCNDDSSGEYPICSSSAVDPDGDGWGWENNQSCIVQ DSSDTAPNGYPYCSQESSDPDGDGWGWENNASMCC
Sequence length 395 AA
Subcellular LocationExtracellular
Function It produces oligosaccharides of various sizes by randomly hydrolyzing the internal ?-1,4-mannosidic linkages in ?-mannan. It also acts on glucomannan and mannooligosaccharides. EC 3.2.1.78. Maximum activity is at pH 6.5 and 40 degree C.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS) staining
Literature
Year of Identification1995
Year of Identification Month Wise1995.12