ProGP124

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP124
Validation Status Uncharacterized
Organism Information
Organism NameVibrio sp. strain MA-138
Domain Bacteria
Classification Family: Vibrionaceae
Order: "Vibrionales"
Class: Gammaproteobacteria
Division or phylum: "Proteobacteria"
Taxonomic ID (NCBI) 269094
Genome Sequence(s)
GenBank D86329
EMBL D86329
Gene Information
Gene NamemanA
Protein Information
Protein Nameβ-1,4-mannanase
UniProtKB/SwissProt ID O69347
EMBL-CDSBAA25188.1
UniProtKB Sequence >tr|O69347|O69347_VIBSM Beta-1,4-mannanase OS=Vibrio sp. (strain MA-138) GN=manA PE=4 SV=1 MKFTKAIFSLLLFIWASCAHAGFYVSNGVLYEANGSAFKIRGINHAHTWYTDKLSVALSG IAATGANTVRVVLSNGYRWTKNDVSDVTNIINLAKANNLIAILEVHDTTGYGEESSAASL DSAADYWIELKNELIGQEDYVIINLGNEPFGNNNDAVAWVNDHVSAIQRLRSAGINHTIM VDAPNWGQDWKGFMLNNAQFVFNSDPKLNTIFSVHMYEVYSSYNSVNDYISSFTNNGLVL VIGEFASTHKGADVDEGSIMERSETLSLGYIGWSWSGNDTTTSDLDIVNNWDNNSYSTWG NVLINGQNGIKSTSTLATVFTCGNDCNDDSSGEYPICSSSAVDPDGDGWGWENNQSCIVQ DSSDTAPNGYPYCSQESSDPDGDGWGWENNASMCC
Sequence length 395 AA
Subcellular LocationExtracellular
Function It produces oligosaccharides of various sizes by randomly hydrolyzing the internal β-1,4-mannosidic linkages in β-mannan. It also acts on glucomannan and mannooligosaccharides. EC 3.2.1.78. Maximum activity is at pH 6.5 and 40 degree C.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff (PAS) staining
Literature
Year of Identification1995
Year of Identification Month Wise1995.12
ReferenceTamaru, Y., Araki, T., Amagoi, H., Mori, H. and Morishita, T. (1995) Purification and characterization of an extracellular beta-1,4-mannanase from a marine bacterium, Vibrio sp. strain MA-138. Appl Environ Microbiol, 61, 4454-4458. [PubMed: 8534110]
AuthorTamaru, Y., Araki, T., Amagoi, H., Mori, H. Morishita, T.
Research GroupFaculty of Bioresources, Mie University, Japan.
Corresponding Author Morishita, T.
ContactFaculty of Bioresources, Mie University, Japan.