ProGP127

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP127
Validation Status Uncharacterized
Organism Information
Organism NameThermoplasma volcanium DSM 4299
Domain Archaea
Classification Family: Thermoplasmataceae
Order: Thermoplasmatales
Class: Thermoplasmata
Division or phylum: "Euryarchaeota"
Taxonomic ID (NCBI) 273116
Genome Sequence(s)
GenBank BA000011.4
EMBL BA000011
Gene Information
Gene NameTVN0607
NCBI Gene ID 1441713
Protein Information
Protein NameFlagellin B1 (41 kDa)
UniProtKB/SwissProt ID P57719
NCBI RefSeq NP_111126.1
EMBL-CDSBAB59749.1
UniProtKB Sequence >sp|P57719|FLA1_THEVO Flagellin B1 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / IFO 15438 / JCM 9571 / GSS1) GN=TV0607 PE=1 SV=2 MNKLLRKVRKAFSLKADNKAETGIGTLIVFIAMVLVAAVAATVLVHTAGTLQQKATSTGS QTTQQVSTGIQVNSIYGLDSNKSVPTHGVIEWLAIQISITAGSSPINLANVTISLTYHGV SASLTYVGLENIGNATVTNDVYGFNSAVGGTNNVFNSSYFKTINGASNGSKHFAILVLSD PTNSMTAQYPVISYEDQVDLLVNVSAVFGGITEGQAVSGEVQAPVGSPGVIQFTAPESFV SDVIQLQ
Sequence length 247 AA
Subcellular LocationSecreted
Function Flagellin is the subunit protein which polymerizes to form the filaments of archaeal flagella.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionPAS staining.
Literature
Year of Identification1996
Year of Identification Month Wise1996.2
Reference1) Faguy, D.M., Bayley, D.P., Kostyukova, A.S., Thomas, N.A. and Jarrell, K.F. (1996) Isolation and characterization of flagella and flagellin proteins from the Thermoacidophilic archaea Thermoplasma volcanium and Sulfolobus shibatae. J Bacteriol, 178, 902-905. [PubMed: 8550530]
Author Jarrell, K.F.
Research GroupDepartment of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada.
Corresponding Author Faguy, D.M., Bayley, D.P., Kostyukova, A.S., Thomas, N.A. Jarrell, K.F.
ContactDepartment of Microbiology and Immunology, Queen's University, Kingston, Ontario, Canada.