ProGP128

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP128
Validation Status Uncharacterized
Organism Information
Organism NameSynechococcus sp. strain WH8102
Domain Bacteria
Classification Family: Synechococcaceae
Order: Synechococcales
Division or phylum: "Cyanobacteria"
Taxonomic ID (NCBI) 84588
Genome Sequence(s)
GenBank GQ856797 
EMBL GQ856797 
Gene Information
Gene NameswmA
Protein Information
Protein NameSwmA (S-layer protein)
UniProtKB/SwissProt ID Q7UA16
UniProtKB Sequence >tr|Q7UA16|Q7UA16_SYNPX Cell-surface-associated polypeptide SwmA OS=Synechococcus sp. (strain WH8102) GN=swmA PE=4 SV=1 MTSRVISRYPSSEAIIHIPSVATLTTVAGGTSNPDYIEVSELKDWFLDAKEGNDEVVVEE TSTGFELYGAGDSDTLTAMGDVADAMIKGGAAADYITIKGATTNTSVYGGKAADSITFDR AVVGGVVYGDTNKDTITFTDKVSGGTIVDGGADDDSLTFNKRITSVTVRGGAARDAISVA ESLDSLVDAGGDNDNLSISGSHSNLIAKGGEGADTLDLTLAGTGNRFYGGKDNDSIKIDT AAAVAVHGDNDNDTIEIASVVSGASVFGGDGADTLSLTAARAGSELVAKGNSGNDKIDGA TSESDETIFGGQGNDTIISSADGSRTYYGDKGDDVISIGTNEASMVSGGEGADSINVNTV VTAADEKFHTVIGGAGVDTIVAAGSTDAKYATSLQYSSFAEFFTAGDVVDSITVGDGTYV KANVAEALSFIDIDSFDRVTMSAGTDGKRTIAAEGLIIATTDAVTTGSSIVFDSSAEDYI AGIDLSASATTAGSLIDNSAGNGATQGMILKGTEGDNTILGGDGADQITGGSGGDSLTGG EGADTIDAGTEGTDILVGGDGDDYLDLNTDLSKDDLITGGDGTDTIAFSHKSASTNILDR VSEVEVVKLENAKDNASITLLDTTIASGKSLTVTTNNASFTGKLTFNASAETDGSVNVTG GASADTITGSAGADTFNGGGGVDSITGGLGIDFYDFSTVANWGDTITDYGKSTATANAQN TTALSNEAISLNGEALAFSDAAISSNANSAIVGSYTPPSGDNASTFNATALKSGTTAAPA VVDQAYAQFLYNTDTGVLSFDADGTGTNNTAVTVATLLNGATAPTLTSTDLVIFA
Sequence length 835 AA
Function S-layer protein SwmA (130 kDa) is needed for nonflagellar swimming in marine Synechococcus.
Glycosylation Status
Technique(s) used for Glycosylation DetectionPeriodic acid-Schiff staining and aberrant migration on SDS-PAGE
Literature
Year of Identification1996
Year of Identification Month Wise1996.6
ReferenceMcCarren J, Brahamsha B. (2009) Swimming motility mutants of marine Synechococcus affected in production and localization of the S-layer protein SwmA. J Bacteriol., 191, 1111-4. [PMID: 19060148]
AuthorMcCarren J, Brahamsha B.
Research GroupMarine Biology Research Division, Scripps Institution of Oceanography, University of California, San Diego, La Jolla, CA 92093-0202, USA.
Corresponding Author Brahamsha B.
ContactMarine Biology Research Division, Scripps Institution of Oceanography, University of California, San Diego, La Jolla, CA 92093-0202, USA.
Reference Brahamsha B. (1996) An abundant cell-surface polypeptide is required for swimming by the nonflagellated marine cyanobacterium Synechococcus. Proc Natl Acad Sci U S A., 93, 6504-9. [PMID: 8692845]
AuthorBrahamsha B
Research GroupCenter for Marine Biotechnology and Biomedicine, Scripps Institution of Oceanography, University of California at San Diego,
Corresponding Author Brahamsha B
ContactCenter for Marine Biotechnology and Biomedicine, Scripps Institution of Oceanography, University of California at San Diego,