ProGP140 (α-Glucosidase (thermostable) 160 kDa)

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP140 (α-Glucosidase (thermostable) 160 kDa)
Validation Status Uncharacterized
Organism Information
Organism NameThermoanaerobacter thermohydrosulfuricus DSM 567
Domain Bacteria
Classification Family: Thermoanaerobacteraceae
Order: Thermoanaerobacterales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1516
Genome Information
GenBank M28471
EMBL M28471
Gene Information
Gene Nameapu
Protein Information
Protein Nameα-Glucosidase (thermostable) 160 kDa (Amylopullulanase)
UniProtKB/SwissProt ID P16950
EMBL-CDSAAA23205.1
UniProtKB Sequence >sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus GN=apu PE=1 SV=1 MFKRRALGFLLAFLLVFTAVFGSMPMEFAKAETDTAPAIANVVGNFQSKLGDSDWNINSD KTIMTYKGNGFYEFTTPVALPAGDYEYKVALNHSWEGGGVPSQGNLSFHLDSDSVVTFYY NYNTSSITDSTKYTPIPEDKLPRLVGTIQPAIGAGDDWKPETSTAIMRDYKFNNVYEYTA NVPKGNYEFKVTLGPSWDINYGLNGEQNGPNIPLNVAYDTKITFYYDSVSHNIWTDYNPP LTGPDNNIYYDDLRHDTHDPFFRSPFGAIKTGDTVTLRIQAKNHDIESAKISYWDDIKKT RIEVPMYRIGQSPDGKYEYWEVKLSFDHPTRIWYYFILKDGTKTAYYGDNDEQLGGVGKA TDTENKDFELTVYDKNLDTPDWMKGSVMYQIFPDRFFNGDSSNDHLKKYSRGFDPVEYHS NWYELPDNPNDKNKLGYTGDGIWSNDFFGGDLKGIDDKLDYLKSLGISVIYLNPIFQSPS NHRYDTTDYTKIDELLGDLSTFKKLMEDAHAKGIKVILDGVFNHTSDDSIYFDRYGKYLN TGVLGAYQAWKQGDQSKSPYGDWYEIKPDGTYEGWWGFDSLPVIRQINGSEYNVKSWADF IINNPNAISKYWLNPDGDKNVGADGWRLDVANEVAHDFWVHFRGAINTVKPNAPMVAENW NDASLDLLGDSFNSVMNYLFRNAVIDFILDKSFDDGNVVHNPIDAAKLDQRLMSIYERYP LPVFYSTMNLLGSHDTMRILTVFGYNSADENQNSQAAKDLAVKRLKLAAILQMGYPGMPS IYYGDEAGQSGGKDPDNRRTFPWGREDTDLQTFFKKVVNIRNENQVLKTGDLETLYANGD VYAFGRRIINGKDTFGKSYPDSVAIVVINKGDAKQVSIDTTKFIRDGVAFTDALSGKTYT VQDGKIVVEVGSMDGAILISDTGQNLTAPQPITDLKAVSGNGKVDLSWSVVDKAVSYNIY RSTVKGGLYEKIASNVTQITYTDTEVTNGLKYVYAVTAVDNDGNESALSNEVEAYPAFPI GWAGNMNQVNTHVIGVNNPVEVYAEVWAQGLTDKPGQGENMIAQLGYRYIGDTVGDAVYN AVYNKVEGVEISKDWTWVDAQYVGDSGNNDKYMAKFVPDMVGTWEYIMRFSSNQGHDWTY TKGPDGKTDEAKQFTVVPSNDVETPTAPVLQQPGIESSRVTLNWSPSADDVAIFGYEIYK SSSETGPFIKIATVSDSVYNYVDTDVVNGNVYYYKVVAVDTSYNRTASNTVKATPDIIPI KVTFNVTIPDYTPDDGVNIAGNFPDAFWNPNANQMTKAGSNTYSITLTLNEGTQIEYKYA RGSWDKVEKGEYGNEIDNRKITVVNQGSNTMVVNDTVQRWRDVPIYIYSPKDKTIVDANT SEIEIKGNTYKGAKVTINDESFVQQENGVFTKVVPLEYGVNTIKIHVEPSGDKNNELTKD ITITVTREKPARRQNLLLLHQQKQQNHLKKYHKAK
Sequence length 1475 AA
Function Exhibits maltase, glucohydrolase (release of glucose from starch and pullulan) and `maltodextrinohydrolase' activity.
Glycosylation Status
Technique(s) used for Glycosylation DetectionGlycoprotein detection kit (GlykoTrack Kit)
Literature
Year of Identification1997
Year of Identification Month Wise1997.11