ProGP140

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP140
Validation Status Uncharacterized
Organism Information
Organism NameThermoanaerobacter thermohydrosulfuricus DSM 567
Domain Bacteria
Classification Family: Thermoanaerobacteraceae
Order: Thermoanaerobacterales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1516
Genome Sequence(s)
EMBL M28471
Gene Information
Gene Nameapu
Protein Information
Protein Nameα-Glucosidase (thermostable) 160 kDa. Also called amylopullulanase.
UniProtKB/SwissProt ID P16950
EMBL-CDSAAA23205.1
UniProtKB Sequence >sp|P16950|APU_THETY Amylopullulanase OS=Thermoanaerobacter thermohydrosulfuricus GN=apu PE=1 SV=1 MFKRRALGFLLAFLLVFTAVFGSMPMEFAKAETDTAPAIANVVGNFQSKLGDSDWNINSD KTIMTYKGNGFYEFTTPVALPAGDYEYKVALNHSWEGGGVPSQGNLSFHLDSDSVVTFYY NYNTSSITDSTKYTPIPEDKLPRLVGTIQPAIGAGDDWKPETSTAIMRDYKFNNVYEYTA NVPKGNYEFKVTLGPSWDINYGLNGEQNGPNIPLNVAYDTKITFYYDSVSHNIWTDYNPP LTGPDNNIYYDDLRHDTHDPFFRSPFGAIKTGDTVTLRIQAKNHDIESAKISYWDDIKKT RIEVPMYRIGQSPDGKYEYWEVKLSFDHPTRIWYYFILKDGTKTAYYGDNDEQLGGVGKA TDTENKDFELTVYDKNLDTPDWMKGSVMYQIFPDRFFNGDSSNDHLKKYSRGFDPVEYHS NWYELPDNPNDKNKLGYTGDGIWSNDFFGGDLKGIDDKLDYLKSLGISVIYLNPIFQSPS NHRYDTTDYTKIDELLGDLSTFKKLMEDAHAKGIKVILDGVFNHTSDDSIYFDRYGKYLN TGVLGAYQAWKQGDQSKSPYGDWYEIKPDGTYEGWWGFDSLPVIRQINGSEYNVKSWADF IINNPNAISKYWLNPDGDKNVGADGWRLDVANEVAHDFWVHFRGAINTVKPNAPMVAENW NDASLDLLGDSFNSVMNYLFRNAVIDFILDKSFDDGNVVHNPIDAAKLDQRLMSIYERYP LPVFYSTMNLLGSHDTMRILTVFGYNSADENQNSQAAKDLAVKRLKLAAILQMGYPGMPS IYYGDEAGQSGGKDPDNRRTFPWGREDTDLQTFFKKVVNIRNENQVLKTGDLETLYANGD VYAFGRRIINGKDTFGKSYPDSVAIVVINKGDAKQVSIDTTKFIRDGVAFTDALSGKTYT VQDGKIVVEVGSMDGAILISDTGQNLTAPQPITDLKAVSGNGKVDLSWSVVDKAVSYNIY RSTVKGGLYEKIASNVTQITYTDTEVTNGLKYVYAVTAVDNDGNESALSNEVEAYPAFPI GWAGNMNQVNTHVIGVNNPVEVYAEVWAQGLTDKPGQGENMIAQLGYRYIGDTVGDAVYN AVYNKVEGVEISKDWTWVDAQYVGDSGNNDKYMAKFVPDMVGTWEYIMRFSSNQGHDWTY TKGPDGKTDEAKQFTVVPSNDVETPTAPVLQQPGIESSRVTLNWSPSADDVAIFGYEIYK SSSETGPFIKIATVSDSVYNYVDTDVVNGNVYYYKVVAVDTSYNRTASNTVKATPDIIPI KVTFNVTIPDYTPDDGVNIAGNFPDAFWNPNANQMTKAGSNTYSITLTLNEGTQIEYKYA RGSWDKVEKGEYGNEIDNRKITVVNQGSNTMVVNDTVQRWRDVPIYIYSPKDKTIVDANT SEIEIKGNTYKGAKVTINDESFVQQENGVFTKVVPLEYGVNTIKIHVEPSGDKNNELTKD ITITVTREKPARRQNLLLLHQQKQQNHLKKYHKAK
Sequence length 1475 AA
Function Exhibits maltase, glucohydrolase (release of glucose from starch and pullulan) and `maltodextrinohydrolase' activity.
Glycosylation Status
Glycosylation Type Information currently not available with us.
Glycosite Sequence Logo
Technique(s) used for Glycosylation DetectionGlycoprotein detection kit (GlykoTrack Kit)
Literature
Year of Identification1997
Year of Identification Month Wise1997.11
Reference1) Wimmer, B., Lottspeich, F., Ritter, J. and Bronnenmeier, K. (1997) A novel type of thermostable alpha-D-glucosidase from Thermoanaerobacter thermohydrosulfuricus exhibiting maltodextrinohydrolase activity. Biochem J, 328 ( Pt 2), 581-586. [PubMed: 9371718]
Author Wimmer, B., Lottspeich, F., Ritter, J. Bronnenmeier, K.
Research GroupInstitute for Microbiology, Technical University Munich, Arcisstrasse 21, D-80290 München, Germany.
Corresponding Author Bronnenmeier, K.
ContactInstitute for Microbiology, Technical University Munich, Arcisstrasse 21, D-80290 München, Germany.