ProGP147

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP147
Validation Status Uncharacterized
Organism Information
Organism NameClostridium tyrobutyricum ATCC 25755
Domain Bacteria
Classification Family: Clostridiaceae
Order: Clostridiales
Class: Clostridia
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1519
Genome Sequence(s)
EMBL AJ242662
Gene Information
Gene Namefla
Protein Information
Protein NameFlagellin
UniProtKB/SwissProt ID P80583
EMBL-CDSCAB44444.1
UniProtKB Sequence >sp|P80583|FLA_CLOTY Flagellin (Fragment) OS=Clostridium tyrobutyricum GN=fla PE=1 SV=2 MIINHNLMANNALRNMNVNSNNASKAMEKLSSGLRINRAGDDAAGLAISEKMRGQINGLN QASSNAQDSISLIQTAEGALNETHSILQRMRTLAVQSSNDTNTTTDRSAIQDEVNQLTDE IDRIANTTEFNTQKLLDGSKVGLVDAKDADASVQLNTSANISLASNFSTTSATGIADSFT VTITRTHGTAGATFASTDYDVALVGGTELIEHSSSSLTYDTKAINLVGMIKCFSIRTNDT IRKVSHVRTVKALSMQIGAIVTNMLIGINSMKATDIGVRNTSGKALDISTASKATGAITQ INNAIETVSTQRSKLGAYQNRLEHTINNLGTSSENLTSAESRIRDVDMASEMSEYSKNNI LSQTAQAMLAQANQQTQ
Sequence length 377 AA
Subcellular LocationSecreted (flagellum)
Function Flagellin is the subunit protein which polymerizes to form the filaments of flagella.
Literature
Year of Identification1998
Year of Identification Month Wise1998.02
ReferenceBedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. and Malcoste, R. (1998) Partial analysis of the flagellar antigenic determinant recognized by a monoclonal antibody to Clostridium tyrobutyricum. Microbiol Immunol, 42, 87-95. [PubMed: 9572040]
AuthorBedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. Malcoste, R.
Research GroupUniversité de Bretagne Occidentale, Institut Universitaire de Technologie de Quimper, Laboratoire Universitaire de Microbiologie Appliquée de Quimper, France
Corresponding Author Malcoste, R.
ContactUniversité de Bretagne Occidentale, Institut Universitaire de Technologie de Quimper, Laboratoire Universitaire de Microbiologie Appliquée de Quimper, France
Reference1) Bedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. and Binet, A. (1998) Evidence for an heterogeneous glycosylation of the Clostridium tyrobutyricum ATCC 25755 flagellin. Microbios, 94, 183-192. [PubMed: 9853380]
AuthorBedouet, L., Arnold, F., Robreau, G., Batina, P., Talbot, F. and Binet, A
Research GroupUniversité de Bretagne Occidentale, Institut Universitaire de Technologie de Quimper, Laboratoire Universitaire de Microbiologie Appliquée de Quimper, France.
Corresponding Author Binet, A
ContactUniversité de Bretagne Occidentale, Institut Universitaire de Technologie de Quimper, Laboratoire Universitaire de Microbiologie Appliquée de Quimper, France.
ReferenceBeguin, P. and Lemaire, M. (1996) The cellulosome: an exocellular, multiprotein complex specialized in cellulose degradation. Crit Rev Biochem Mol Biol, 31, 201-236.
AuthorBeguin, P. Lemaire, M.
Research GroupUnité de Physiologie Cellulaire and URA 1300 CNRS, Départment des Biotechnologies, Institut Pasteur, Paris, France.
Corresponding Author Lemaire, M.
ContactUnité de Physiologie Cellulaire and URA 1300 CNRS, Départment des Biotechnologies, Institut Pasteur, Paris, France.