ProGP149

Home -> ProGPdb -> Search ProGP -> Display data

ProGP ID ProGP149
Validation Status Uncharacterized
Organism Information
Organism NameBacillus circulans K-1
Domain Bacteria
Classification Family: Bacillaceae
Order: Bacillales
Class: Bacilli (or Firmibacteria)
Division or phylum: "Firmicutes"
Taxonomic ID (NCBI) 1397
Genome Sequence(s)
GenBank AB007123
EMBL AB007123
Gene Information
Gene NameG-gene
Protein Information
Protein Nameβ-1,4-mannanase (G-enzyme)
UniProtKB/SwissProt ID O66185
EMBL-CDSBAA25878.1
UniProtKB Sequence >tr|O66185|O66185_BACCI Mannanase OS=Bacillus circulans PE=4 SV=1 MGWFLVILRKWLIAFVAFLLMFSWTGQLTNKAHAASGFYVSGTKLLDATGQPFVMRGVNH AHTWYKDQLSTAIPAIAKTGANTIRIVLANGHKWTLDDVNTVNNILTLCEQNKLIAVLEV HDATGSDSLSDLDNAVNYWIGIKSALIGKEDRVIINIANEWYGTWDGVAWANGYKQAIPK LRNAGLTHTLIVDSAGWGQYPDSVKNYGTEVLNADPLKNTVFSIHMYEYAGGNASTVKSN IDGVLNKNLALIIGEFGGQHTNGDVDEATIMSYSQEKGVGWLAWSWKGNSSDLAYLDMTN DWAGNSLTSFGNTVVNGSNGIKATSVLSGIFGGVTPTSSPTSTPTSTPTSTPTPTPSPTP SPGNNGTILYDFETGTQGWSGNNISGGPWVTNEWKATGAQTLKADVSLQSNSTHSLYITS NQNLSGKSSLKATVKHANWGNIGNGIYAKLYVKTGSGWTWYDSGENLIQSNDGTILTLSL SGISNLSSVKEIGVEFRASSNSSGQSAIYVDSVSLQ
Sequence length 516 AA
Subcellular LocationIntracellular
Function Degrades guar gum which consists of a galactomannosaccharide from the endosperm of guar seeds.
Glycosylation Status
Technique(s) used for Glycosylation DetectionMass shift detected on SDS-polyacrylamide gel, periodic acid-Schiff (PAS) staining
Glycan Information
Glycan Annotation Recombinant G-enzyme (expressed in E. coli) shows GalNAc, Xyl, GlcNAc, Man, Glc, and Gal to account for 1.7%, 14.4%, 6.1%, 3.2%, 54.2%, and 10.4%, respectively, of total monosaccharides. G-enzyme from strain K-1 contains GalNAc, Xyl, GlcNAc, Man, Fuc, and Gal that account for 1.8%, 0.9%, 11.0%, 6.1%, 1.1%, and 79.1%, respectively, of total monosaccharides.
Literature
Year of Identification1998
Year of Identification Month Wise1998.03
ReferenceYoshida, S., Sako, Y. and Uchida, A. (1998) Cloning, sequence analysis, and expression in Escherichia coli of a gene coding for an enzyme from Bacillus circulans K-1 that degrades guar gum. Biosci Biotechnol Biochem, 62, 514-520. [PubMed: 9571781]
Author Yoshida, S., Sako, Y. Uchida, A.
Research GroupResearch Institute of Technology, Konoike Construction Co., Ltd., Ibaraki, Japan.
Corresponding Author Uchida, A.
ContactResearch Institute of Technology, Konoike Construction Co., Ltd., Ibaraki, Japan.